[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36391.1
DDBJ      :             astB/chuR-related protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:463 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   180->257 2wjyA PDBj 7e-04 29.7 %
:RPS:PDB   82->413 3cixA PDBj 2e-11 12.7 %
:RPS:SCOP  84->248 1tv7A  c.1.28.3 * 6e-08 20.7 %
:HMM:SCOP  81->418 1tv8A_ c.1.28.3 * 1.2e-33 24.1 %
:HMM:PFM   87->241 PF04055 * Radical_SAM 1.7e-16 17.9 140/166  
:BLT:SWISS 3->86 RRFC_DAUCA 3e-04 30.5 %
:BLT:SWISS 89->418 ANSME_CLONN 8e-14 31.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36391.1 GT:GENE AAD36391.1 GT:PRODUCT astB/chuR-related protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1335551..1336942 GB:FROM 1335551 GB:TO 1336942 GB:DIRECTION + GB:PRODUCT astB/chuR-related protein GB:NOTE similar to SP:Q02550 PID:143939 percent identity: 46.97; identified by sequence similarity; putative GB:PROTEIN_ID AAD36391.1 GB:DB_XREF GI:4981877 LENGTH 463 SQ:AASEQ MITINLPKVFFSLIEAPRNNRYLLDKVNFDFYKLDDSIQITRKASSYLVRTKAKNVIEELEKLKKNTLISLKRKLVKDNDILRLALNVSQVCRLKCRYCYANAGTYGNPGFMKRNVLVRTLDFFLSNYNVHNIHIFGGEPLLNIEMIEEMFRILTSKYAKKFNNLRITVATSLFVSEETINRFIKIYESYKDKFQIYMVVSLDGPKEIQDNTRPSLDSKSSSFDRIKNNINLLKQKGFSISFEVTYTKLHKQLGWNILKIYKYFYTEFNAANVIISPVYDWNGSLDKNLRIDISIAQEYYEIIASLLEKSRRGDLNDFDRALLCKLLMNYLNPSDSSGKIIVSTFCPAGSNSFIVDIFGNIYPCQLVVGNLKYRISNVVKDNEEKILKNLKDWRYKALRLFTKARYSKCKDCYFLFYCSRCIFKRDYQKDMFKACDVEKKIIETILEFDPWTLLPLMDNFNGG GT:EXON 1|1-463:0| BL:SWS:NREP 2 BL:SWS:REP 3->86|RRFC_DAUCA|3e-04|30.5|82/227| BL:SWS:REP 89->418|ANSME_CLONN|8e-14|31.3|297/374| BL:PDB:NREP 1 BL:PDB:REP 180->257|2wjyA|7e-04|29.7|74/773| RP:PDB:NREP 1 RP:PDB:REP 82->413|3cixA|2e-11|12.7|291/345| HM:PFM:NREP 1 HM:PFM:REP 87->241|PF04055|1.7e-16|17.9|140/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 84->248|1tv7A|6e-08|20.7|150/327|c.1.28.3| HM:SCP:REP 81->418|1tv8A_|1.2e-33|24.1|294/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 124 OP:NHOMOORG 86 OP:PATTERN --------1-1-1111-------------------11-----------2-11--1---11-----1-- ---------------------------------------------------------------------------------------121-1-1------------------------------------1----1----------------------------------------------------2-----------2-------------------------------------------------------------------------------------------------------------------111----2112111123121214222222111141-121-111111-11134321---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------1------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------35-111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 350 STR:RPRED 75.6 SQ:SECSTR ##############################################ccccEEEEEEEEEEEEEEEEEEEEcccEEETTEEEEEEEEEEEcccccccTTcTTcTTcccccccccHHHHHHHHHHHHHTTccEEEEEEcccGGGTTHHHHHHHHHHTTEEHTTccEEEEEEEccHHHcGGcccccHHHHHHHHHTTccEEEcccccccHHHHHHHcccccTTccHHHHHHHHHHHHTTcccEEEEccEEccTTccHHHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHHHHcTTccEEE############ccccHHHHHHcTTHHHHHHTTTccEEccccccTTTGGGcccccccTTTTccTTcHHHHHHHHHHHTTcEEcccc#####ccccccc################################################## DISOP:02AL 462-463| PSIPRED cEEEEEEEEEEEEEEEccccEEEEHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHHccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccccEEEccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc //