[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36398.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:285 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   149->238 PF01061 * ABC2_membrane 4e-08 31.1 %
:HMM:PFM   36->238 PF01061 * ABC2_membrane 9.8e-18 23.2 185/208  
:BLT:SWISS 80->271 YBHR_SHIFL 5e-09 21.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36398.1 GT:GENE AAD36398.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1346236..1347093 GB:FROM 1346236 GB:TO 1347093 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 56.56; identified by sequence similarity; putative GB:PROTEIN_ID AAD36398.1 GB:DB_XREF GI:4981885 LENGTH 285 SQ:AASEQ MFHGGSEFSSGGEGHLKLLIKTLYFIRKDILIWLSYRTQLVLGLLSGFVGIVQFGFIGKFIAQGNYFPLIERYGGDILAYFITGSVFMSYTNLALMTFKGVIQREQSMGTLEYILLSKTPLWQLFLFSFVSSFFFTTLNITLIFLGLVYLFSVHITPNFLEALVVLFTVMLPLMGIGLLSASIVLVTKRGDPVGWLYTTLSGLFSGIYFPVEILPDWIRPVSYLIPSTYGIDLLRRVLMRGEHLSSVSEGLVLLAATGTVLISAGIVAFKRSFNQARLRGSLSWY GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 80->271|YBHR_SHIFL|5e-09|21.8|188/368| TM:NTM 7 TM:REGION 14->36| TM:REGION 40->62| TM:REGION 78->100| TM:REGION 127->149| TM:REGION 163->185| TM:REGION 193->215| TM:REGION 248->269| SEG 2->15|fhggsefssggegh| SEG 47->61|gfvgivqfgfigkfi| SEG 124->147|lflfsfvssfffttlnitliflgl| RP:PFM:NREP 1 RP:PFM:REP 149->238|PF01061|4e-08|31.1|90/208|ABC2_membrane| HM:PFM:NREP 1 HM:PFM:REP 36->238|PF01061|9.8e-18|23.2|185/208|ABC2_membrane| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 39 OP:NHOMOORG 33 OP:PATTERN -------11111111111-------------------------------------1------------ ---------------------------------------------------------------------------1-------------------------------------------------1-----1---1---111111---------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22-121222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 281-285| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //