[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36409.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  48/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.70.1
:258 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  19->241 1kb0A2 b.70.1.1 * 5.8e-08 26.1 %
:BLT:SWISS 75->232 YL264_MIMIV 2e-05 28.8 %
:PROS 67->72|PS00125|SER_THR_PHOSPHATASE
:TM
:REPEAT 4|31->81|89->139|147->197|205->255

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36409.1 GT:GENE AAD36409.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1358392..1359168) GB:FROM 1358392 GB:TO 1359168 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36409.1 GB:DB_XREF GI:4981897 LENGTH 258 SQ:AASEQ MSKMFITVFFGIMLVTVSLICIAETAPEIIWQKILGGSSDDYAFSIQQTPDGGYIVAGYTESNDGDVKGNHENGDFWIVKLDKDGNIEWQKTLGGSNWDWAFSVQQTPDGGYIVAGFTWSNDGDVSGNHGSLDAWIVKLDKDGNIEWQKTLGGSGNDWATSVQQTTDGGYIVAGGTYSTDGVIRGNHGSLDAWVVKLDGNGNMQWQKALGGSGSDSAWSVQQTTDGGYIVAGFTKSNDGDVTGNHGSADFWVVKLGWQ GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 75->232|YL264_MIMIV|2e-05|28.8|156/100| PROS 67->72|PS00125|SER_THR_PHOSPHATASE|PDOC00115| TM:NTM 1 TM:REGION 8->30| NREPEAT 1 REPEAT 4|31->81|89->139|147->197|205->255| HM:SCP:REP 19->241|1kb0A2|5.8e-08|26.1|180/0|b.70.1.1|1/1|Quinoprotein alcohol dehydrogenase-like| OP:NHOMO 120 OP:NHOMOORG 63 OP:PATTERN ----1-----------------------------1--------11-331-21---1-A2-3---1--- --3------------------------------------------------------------------------------------------------1-2--1112-------------------1--------122----------1-------1--------2--13-----------------46-------------------------------------------------------------------------------------------------------------------------------------1-------1--1---------------------11-11----1----------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------1--------------------------2A-6--------------------1---2-----------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------11--22------------------------------------2-21112111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHcEEEEEEEcccccEEEEEEEcccccEEEEEEEEcccccEEEEEEEcccccccccccccccEEEEEEcccccEEEEEEEcccccccEEEEEEcccccEEEEEEEcccccccccccccccEEEEEEcccccEEEEEEEccccccEEEEEEEcccccEEEEEEEcccccccccccccccEEEEEEcccccEEEEEEEcccccccEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEccc //