[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36417.1
DDBJ      :             processing protease, putative
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  674/915 : Eukaryota  190/199 : Viruses  1/175   --->[See Alignment]
d.185.1
:412 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->263 1hr6H PDBj 9e-22 28.5 %
:RPS:PDB   7->408 1bccA PDBj 1e-70 22.4 %
:RPS:SCOP  7->192 1bccB1  d.185.1.1 * 3e-42 17.3 %
:RPS:SCOP  224->404 1hr6A2  d.185.1.1 * 5e-31 20.4 %
:HMM:SCOP  9->216 1ezvB1 d.185.1.1 * 4.5e-46 32.5 %
:HMM:SCOP  219->401 1be3B2 d.185.1.1 * 3e-33 27.3 %
:RPS:PFM   13->140 PF00675 * Peptidase_M16 4e-21 35.2 %
:RPS:PFM   163->327 PF05193 * Peptidase_M16_C 5e-15 31.5 %
:HMM:PFM   18->155 PF00675 * Peptidase_M16 8.8e-35 33.3 138/149  
:HMM:PFM   162->318 PF05193 * Peptidase_M16_C 3.7e-31 30.6 157/183  
:BLT:SWISS 20->383 YMXG_BACSU 5e-41 29.4 %
:PROS 31->54|PS00143|INSULINASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36417.1 GT:GENE AAD36417.1 GT:PRODUCT processing protease, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1365017..1366255 GB:FROM 1365017 GB:TO 1366255 GB:DIRECTION + GB:PRODUCT processing protease, putative GB:NOTE similar to SP:Q04805 percent identity: 51.10; identified by sequence similarity; putative GB:PROTEIN_ID AAD36417.1 GB:DB_XREF GI:4981906 LENGTH 412 SQ:AASEQ MERHTVNEIEIFTIPFDKARTISCAFLIKKGSAHEPEELAGISHFIEHMAFRGTKSYDHFSLKYTVEVVGGTLNAFTDKLATAYYAKVPEFHFGKTLNVLKEITFYPIFSPEDTEIERKIILEEYKMSQDDPTSKLFDTLVETVWPGPYGRPIIGRKETIEKISSEDLREYHRKNYNLPDTKIILAGKVNDDYLSLLEKELSELERNKPGDPLPPPPSFEHTEPRYIVRNDLEQVHIAMARPICGRISEDIYPLYALNTALGSGMSSILFHEIREKEGFVYDVFSQIYALKETGIIIVYAALSPEKIDEFFSKMKDVLSNESLFMKNFEYGKMRYLGKLDMVTDNPAGMMSFVIDDLSNDSLETIEERVERIKNVSKEDYRRAYERFIAGNWSVFGIGPESGKIIEKHEMIV GT:EXON 1|1-412:0| BL:SWS:NREP 1 BL:SWS:REP 20->383|YMXG_BACSU|5e-41|29.4|361/409| PROS 31->54|PS00143|INSULINASE|PDOC00130| SEG 194->205|lsllekelsele| BL:PDB:NREP 1 BL:PDB:REP 7->263|1hr6H|9e-22|28.5|256/440| RP:PDB:NREP 1 RP:PDB:REP 7->408|1bccA|1e-70|22.4|401/442| RP:PFM:NREP 2 RP:PFM:REP 13->140|PF00675|4e-21|35.2|128/145|Peptidase_M16| RP:PFM:REP 163->327|PF05193|5e-15|31.5|162/180|Peptidase_M16_C| HM:PFM:NREP 2 HM:PFM:REP 18->155|PF00675|8.8e-35|33.3|138/149|Peptidase_M16| HM:PFM:REP 162->318|PF05193|3.7e-31|30.6|157/183|Peptidase_M16_C| GO:PFM:NREP 5 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF00675|IPR011765| GO:PFM GO:0006508|"GO:proteolysis"|PF00675|IPR011765| GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF05193|IPR007863| GO:PFM GO:0006508|"GO:proteolysis"|PF05193|IPR007863| GO:PFM GO:0008270|"GO:zinc ion binding"|PF05193|IPR007863| RP:SCP:NREP 2 RP:SCP:REP 7->192|1bccB1|3e-42|17.3|185/218|d.185.1.1| RP:SCP:REP 224->404|1hr6A2|5e-31|20.4|181/237|d.185.1.1| HM:SCP:REP 9->216|1ezvB1|4.5e-46|32.5|200/0|d.185.1.1|1/2|LuxS/MPP-like metallohydrolase| HM:SCP:REP 219->401|1be3B2|3e-33|27.3|183/0|d.185.1.1|2/2|LuxS/MPP-like metallohydrolase| OP:NHOMO 1590 OP:NHOMOORG 871 OP:PATTERN -----------------111111--------------------------------------------- 223-1---------11111-11111111111-111111111111111-1111111111--111-1112122-----------122221222312222---23-33126331------1-1-----11111111161111221112244324441222112111332454631111121211111112211-1122222222222222222133112221211222------121--------------111211111--1111111111111--11---111111111111111111111-------------1--111---121223222233223223222111132--3--1111111123111112111533222211111233343333323322221122122-3353333323211111113111113321-322222222222222222122112222212322232--11111111111112222-221-2-----------------------------2211121111-211211111112122211-------222-1242---1-11212211434233333544552141111111111111111111111121112213112-2315333332333334144344---2111------11-1---1111111111-1111111111111111112---11-1----1----------1--1111111--2--------------311111111111111----1--111--111------11112211112111111122111111111111123343333333433--11111111----1-3111111111111111----------------------------1112111111132 1124112-311-222111111111111111111-111111-1111111111111111111112112211123211322-231221322-11111112212212454-2313362228222323-551628P3-5652312533522321242192324425331223532222412132R3222375651531366532 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 408 STR:RPRED 99.0 SQ:SECSTR #EEEETcccEEEEEEccccccEEEEEEEccccTTccTTTTTHHHHHHHHHccccccccHHHHHHHHHTTTcEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHTTTGGGccccccHHHHHHccHHHHHHHHHHHccGGGEEEEEEEcccHHHHHHHHHHHcccccccHHHHcccccccccccEEEEEcTTcccEEEEEEEEEccTTcGGGTHHHHHHHHHcTTccccHHHHHHHHTTcccEEEEEEEEccccEEEEEEEEEcTTTHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHcTTccccEEEEEccTTHHHHTTc### DISOP:02AL 412-413| PSIPRED cEEEcccccEEEEEEcccccEEEEEEEEcccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccEEEEEEcccEEEEEEEEcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccHHHHHcccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccEEEEEEEEcccccccEEEEEEEEcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcc //