[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36427.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->104 PF04246 * RseC_MucC 7e-08 41.7 %
:HMM:PFM   3->124 PF04246 * RseC_MucC 2.2e-27 38.0 121/135  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36427.1 GT:GENE AAD36427.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1374275..1374655) GB:FROM 1374275 GB:TO 1374655 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36427.1 GB:DB_XREF GI:4981916 LENGTH 126 SQ:AASEQ MYVREVKDGKVVVAKARTSACGSCPAKNICLSDNEIKLEIDWCGEDLKPGDEVVVDIPEYDPLKVSTLVYFLPLVIFAVTVITGYLFRLKDWVTFVLALGSVFAYYSLFRFRRKDRKPPRILRKVS GT:EXON 1|1-126:0| TM:NTM 2 TM:REGION 64->86| TM:REGION 90->110| SEG 109->120|frfrrkdrkppr| RP:PFM:NREP 1 RP:PFM:REP 6->104|PF04246|7e-08|41.7|96/135|RseC_MucC| HM:PFM:NREP 1 HM:PFM:REP 3->124|PF04246|2.2e-27|38.0|121/135|RseC_MucC| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 5-7, 125-126| PSIPRED ccccccccccEEEEEcccccccccccccEEEcccEEEEEEEEccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccc //