[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36428.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  282/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
d.261.1
:474 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->474 1uc2A PDBj e-138 50.4 %
:RPS:SCOP  1->474 1uc2A  d.261.1.1 * e-177 53.4 %
:HMM:SCOP  1->474 1uc2A_ d.261.1.1 * 3e-167 51.9 %
:RPS:PFM   40->474 PF01139 * UPF0027 2e-99 53.8 %
:HMM:PFM   19->474 PF01139 * UPF0027 1.8e-151 50.8 417/420  
:BLT:SWISS 3->474 Y998_PYRAE e-143 52.3 %
:PROS 43->72|PS01288|UPF0027

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36428.1 GT:GENE AAD36428.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1374672..1376096) GB:FROM 1374672 GB:TO 1376096 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000782 percent identity: 71.73; identified by sequence similarity; putative GB:PROTEIN_ID AAD36428.1 GB:DB_XREF GI:4981917 LENGTH 474 SQ:AASEQ MKIERLDKYIWKIPKEGDMKVDAIIFTDAESVNDPQFREAMKQLMNVATLPGIVKYALAMPDIHWGYGFPIGGVAAFDVKEGIISPGGVGFDINCGVRLMKTDLTYEDVKDRMRSLVEAIYEFVPAGVGSTGDIVLGKKGLRKVLVEGAEWAVKSGYGLEEDLERIEDGGKIHPADPSYVSEEAFERGSDELGTLGAGNHFVEVQMVQEIYDEELAEFFGLEIGTITVMIHSGSRGFGHQVATDYIRLMRDNLKEHNKNLPDKQLINAPFEHPLGQAYYSAMNCAANYAFANREILGHLVRKAFWKVFGRDTRVDLIYDVAHNIAKVEEYEVDGKRRKLVVHRKGATRSLGPGSEKVPSIYREVGQPVIIPGDMGTASYLLVGTKKAEEKTFGSTAHGAGRVLGRSAALKKLDYREVLDELAEKNIVVMSKSKKTLVEEAPEVYKDVDRVVQIVHEIGISRKVARMIPLGVVKG GT:EXON 1|1-474:0| BL:SWS:NREP 1 BL:SWS:REP 3->474|Y998_PYRAE|e-143|52.3|472/484| PROS 43->72|PS01288|UPF0027|PDOC00990| BL:PDB:NREP 1 BL:PDB:REP 3->474|1uc2A|e-138|50.4|472/480| RP:PFM:NREP 1 RP:PFM:REP 40->474|PF01139|2e-99|53.8|381/396|UPF0027| HM:PFM:NREP 1 HM:PFM:REP 19->474|PF01139|1.8e-151|50.8|417/420|UPF0027| RP:SCP:NREP 1 RP:SCP:REP 1->474|1uc2A|e-177|53.4|474/480|d.261.1.1| HM:SCP:REP 1->474|1uc2A_|3e-167|51.9|474/480|d.261.1.1|1/1|Hypothetical protein PH1602| OP:NHOMO 540 OP:NHOMOORG 437 OP:PATTERN 111111111111111111111111-11--111111111111111111111111111111111111111 -1--1111111------11-1-----11111-----1111-1-11-1-1----11--1--12--1111111---------1-11-1--111----------2---21111---------------11-------1-111111112111211111---------1---111-------------2-11111----11111-11-1111-111----111-----11------21------------------------------------------------------------------------------------------1--1------------1-----------1---1--1-1-111--1111---12------------22-------------------------1------------------------------------------------------------------------------------1----111111--------------13--111-----2-----31111---11---2---------11-111211-121-1111--11111112111114411--------------------------------2-----------------------1---1111-------1-1---1112122222-1112222232122111112---131111-21212122211112-21-1111-------------------1-1111111-2-----------------11121----11-2223231-1-1------------------------------1111111----------1--------------1---------------------------11-11111111-1 22--111-211---1-------------------------------------------------------------------------------------------121211111211111111111114D1-112111111112111111111111111321311-1111112111119111121-----1-1----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 472 STR:RPRED 99.6 SQ:SECSTR ##cEEccccEEEEcccTTccccEEEEccHHHHHHHHcccHHHHHHHHTTcTTccccEEEEEEEEccccccEEEEEEEETTTcEEcGGGTcccTTcEEEEEcccccHHHHGGGHHHHHHHHHHHccccTTccccccccTTccHHHHHHHHHHHHHTTcccGGGGGGcGGGGccTTccGGGccHHHHHHHGGGccccccTTcEEEEEEEEEEccHHHHHHTTccTTcEEEEEEEccHHHHHHHHHHHHHHHHHHGGGcccccccTTcccEETTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTccEEEEEEcEEEEEEEEEETTEEEEEEEEEEcEEEcccTTcTTccTTTTTTccEEEEcccTTccEEEEEccHHHHHHcccEEEccccccccHHHHHHHccHHHHHHHHHHTTcEEEEccHHHHHHTcGGGcccHHHHHHHHHHHTccEEEEEEEEEEEEEc PSIPRED cccEEEcccEEEEcccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccEEEEEEccccccEEEcccEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccHHHHHHcccccHHHHHHHHcccccccccHHHHHHHHHHHcHHHccccccccEEEEEEEHHHHccHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccEEEEEEEEccccEEEEEcccccccccccccccHHHHHHcccEEEEcccccccEEEEEEcccccHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHcccEEEEcccccHHHccHHHcccHHHHHHHHHHccccEEEEEEEEEEEEcc //