[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36438.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  29/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->112 1l8dB PDBj 2e-04 48.6 %
:RPS:PFM   4->136 PF01927 * DUF82 2e-22 42.4 %
:HMM:PFM   5->143 PF01927 * DUF82 1.2e-34 38.4 138/147  
:BLT:SWISS 5->95 MUT7_HUMAN 1e-05 34.1 %
:BLT:SWISS 74->112 RAD50_PYRFU 5e-04 48.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36438.1 GT:GENE AAD36438.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1376147..1376641 GB:FROM 1376147 GB:TO 1376641 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 58.39; identified by sequence similarity; putative GB:PROTEIN_ID AAD36438.1 GB:DB_XREF GI:4981928 LENGTH 164 SQ:AASEQ MSEVRFAVDASLVPLAKKLRILGVDVKVCYSEEPGKVLLICRKEGRILLTKKCSLIKFFEKYGQKVFYIKDEKDLKRVIEHFKLKPERARCPYCNRELLPTPREEVIEKVPLYVFLNAEKFSRCPSCGRIFWRGSHLDWVKEVIPDGSGETETDKGNKDSGKRG GT:EXON 1|1-164:0| BL:SWS:NREP 2 BL:SWS:REP 5->95|MUT7_HUMAN|1e-05|34.1|91/876| BL:SWS:REP 74->112|RAD50_PYRFU|5e-04|48.6|37/882| BL:PDB:NREP 1 BL:PDB:REP 74->112|1l8dB|2e-04|48.6|37/102| RP:PFM:NREP 1 RP:PFM:REP 4->136|PF01927|2e-22|42.4|132/145|DUF82| HM:PFM:NREP 1 HM:PFM:REP 5->143|PF01927|1.2e-34|38.4|138/147|DUF82| OP:NHOMO 58 OP:NHOMOORG 51 OP:PATTERN 111-111--------1--------------------------------------1111111-111--- --1------------1--------1-------------11------------------------------------------11--------------------------------------------------------111----1--11-----------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1---1-------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------11---212221-- ------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-----11---1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 22.6 SQ:SECSTR #########################################################################HHHHHHH##HHTTccEEcTTTccEEcHHHHHHHHHHHHH#################################################### DISOP:02AL 150-164| PSIPRED cccHHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHcccEEEEccHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccccHHcccccccEEEEccHHHHHHcccHHHHHHccEEEEEccccEEEcccccHHHHHHHHHHHccccccccccccccccc //