[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36442.1
DDBJ      :             nitrogen fixation protein NifU-related protein
Swiss-Prot:NIFU_THEMA   RecName: Full=NifU-like protein;

Homologs  Archaea  20/68 : Bacteria  438/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.224.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->138 1xjsA PDBj 4e-24 36.4 %
:RPS:PDB   1->106 2e5aA PDBj 5e-16 11.3 %
:HMM:SCOP  1->143 1xjsA_ d.224.1.2 * 2.4e-42 45.1 %
:RPS:PFM   6->138 PF01592 * NifU_N 1e-20 47.0 %
:HMM:PFM   7->124 PF01592 * NifU_N 8.2e-22 28.8 118/127  
:BLT:SWISS 1->142 NIFU_THEMA 7e-78 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36442.1 GT:GENE AAD36442.1 GT:PRODUCT nitrogen fixation protein NifU-related protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1390298..1390726 GB:FROM 1390298 GB:TO 1390726 GB:DIRECTION + GB:PRODUCT nitrogen fixation protein NifU-related protein GB:NOTE similar to GB:U00013 PID:466875 PID:2398702 percent identity: 55.07; identified by sequence similarity; putative GB:PROTEIN_ID AAD36442.1 GB:DB_XREF GI:4981933 LENGTH 142 SQ:AASEQ MVFKMMYSEAILDYANSKKFRGKLDDATVIEEGKNISCGDEITLYLKVEDGVVKDAKFEGMGCVISQASASLMLERIIGERVEEIFSLIEEAEKMSRGENFDEGKLKNVTLMSDIKNYPARVKCFILAWKTLKEALKKISRP GT:EXON 1|1-142:0| SW:ID NIFU_THEMA SW:DE RecName: Full=NifU-like protein; SW:GN Name=nifU; OrderedLocusNames=TM_1372; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|NIFU_THEMA|7e-78|100.0|142/142| BL:PDB:NREP 1 BL:PDB:REP 6->138|1xjsA|4e-24|36.4|132/147| RP:PDB:NREP 1 RP:PDB:REP 1->106|2e5aA|5e-16|11.3|106/329| RP:PFM:NREP 1 RP:PFM:REP 6->138|PF01592|1e-20|47.0|115/126|NifU_N| HM:PFM:NREP 1 HM:PFM:REP 7->124|PF01592|8.2e-22|28.8|118/127|NifU_N| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01592|IPR002871| GO:PFM GO:0016226|"GO:iron-sulfur cluster assembly"|PF01592|IPR002871| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF01592|IPR002871| HM:SCP:REP 1->143|1xjsA_|2.4e-42|45.1|142/0|d.224.1.2|1/1|SufE/NifU| OP:NHOMO 489 OP:NHOMOORG 464 OP:PATTERN -----------------------2111111111---------111111--121-----------1--- --11111111111111111-111111111111111111111111--111111111--1--11111111111111111111112---------------------------------------------------1-12221---231--111-1111--------11-------------------111--111111111111111111122211111111111111111111111111111111111111111--11111-111111111111111111111111111111111111111111111111111111111111111112111111111111221111-11111111-11111-1-112211--12-1-----11-11-111--111-1-11111111111---1-----11--111-1-111-1-1------1-------------------1-1-11--1---11--11---1111-11-11112-----------------1111----111111-----1---------11--11-------1-1--------1111-------1-111-1111-----1-2122221--1-----------------------------1---1---11111111111111111111--111-----111--------------------------------------------------------------------------------------11111111111----111--11--------------------1111---------1-----------------------------------------1-1---1111--------1111-11---1----------1-1-----11111111111- 1111----1-------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 97.2 SQ:SECSTR TTTcTTHHHHHHHHHcHHHHTTTcccEEEEEEEEEEccEEEEEEEEEEETTEEEEEEEEccTTTccHHHHHHHHHHHTTccccccTTTccHHHHHHHHHHHHHHTTHHHHHHHHHTTcTTTHHHHHHHHHHHHHHccc#### DISOP:02AL 141-142| PSIPRED ccHHHHHHHHHHHHHHccccccccccccEEEEEcccccccEEEEEEEEEccEEEEEEEEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccc //