[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36451.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->108 PF09184 * PPP4R2 1.5e-05 33.8 68/288  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36451.1 GT:GENE AAD36451.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1398183..1398572 GB:FROM 1398183 GB:TO 1398572 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36451.1 GB:DB_XREF GI:4981942 LENGTH 129 SQ:AASEQ MKKGEKILSFVKQEKELIEDYRKSLHDVKRSDEVGDVFIEFALKFLEKVLEDFKPEEYTEDIAFEPEKESYTLSERLKERIGEDLLKKSDLPAILQRFCEMAAHRWKQLKADEEKTDFFKRPGHEMRRD GT:EXON 1|1-129:0| HM:PFM:NREP 1 HM:PFM:REP 40->108|PF09184|1.5e-05|33.8|68/288|PPP4R2| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 124-129| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHcccc //