[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36469.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:UPPS_THEMA   RecName: Full=Undecaprenyl pyrophosphate synthetase;         Short=UPP synthetase;         EC=2.5.1.31;AltName: Full=Di-trans,poly-cis-decaprenylcistransferase;AltName: Full=Undecaprenyl diphosphate synthase;         Short=UDS;

Homologs  Archaea  67/68 : Bacteria  871/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.101.1
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->228 2vg2D PDBj 2e-53 44.9 %
:RPS:PDB   2->224 2e98A PDBj 5e-83 40.4 %
:RPS:SCOP  3->224 1jp3A  c.101.1.1 * 9e-73 39.1 %
:HMM:SCOP  2->224 1jp3A_ c.101.1.1 * 3.7e-84 57.0 %
:RPS:PFM   10->229 PF01255 * Prenyltransf 2e-61 51.8 %
:HMM:PFM   10->228 PF01255 * Prenyltransf 2.5e-88 53.2 218/223  
:BLT:SWISS 1->233 UPPS_THEMA e-124 100.0 %
:PROS 174->191|PS01066|UPP_SYNTHETASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36469.1 GT:GENE AAD36469.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1413841..1414542) GB:FROM 1413841 GB:TO 1414542 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000657 percent identity: 73.80; identified by sequence similarity; putative GB:PROTEIN_ID AAD36469.1 GB:DB_XREF GI:4981961 LENGTH 233 SQ:AASEQ MRIPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAEVLHNTVKWSLELGIKYLTAFSFSTENWKRPKEEVEFLMDLFVQMIDREMELLRRERVRVRILGRKEGLPEKVLKKWQEVEEKTKEFDRMTLIIAFNYGGRREILDAVEFILKDVSHGKKIELTEETFRQYLYLPDVPDPDLIIRTSGEMRLSNFLLWQSAYSELYFFKKLWPDFTKRDFLRAIESYSKRERRFGGLING GT:EXON 1|1-233:0| SW:ID UPPS_THEMA SW:DE RecName: Full=Undecaprenyl pyrophosphate synthetase; Short=UPP synthetase; EC=2.5.1.31;AltName: Full=Di-trans,poly-cis-decaprenylcistransferase;AltName: Full=Undecaprenyl diphosphate synthase; Short=UDS; SW:GN Name=uppS; OrderedLocusNames=TM_1398; SW:KW Cell cycle; Cell division; Cell shape;Cell wall biogenesis/degradation; Complete proteome;Peptidoglycan synthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->233|UPPS_THEMA|e-124|100.0|233/233| GO:SWS:NREP 6 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 174->191|PS01066|UPP_SYNTHETASE|PDOC00817| SEG 81->98|remellrrervrvrilgr| BL:PDB:NREP 1 BL:PDB:REP 2->228|2vg2D|2e-53|44.9|227/284| RP:PDB:NREP 1 RP:PDB:REP 2->224|2e98A|5e-83|40.4|223/226| RP:PFM:NREP 1 RP:PFM:REP 10->229|PF01255|2e-61|51.8|220/222|Prenyltransf| HM:PFM:NREP 1 HM:PFM:REP 10->228|PF01255|2.5e-88|53.2|218/223|Prenyltransf| GO:PFM:NREP 1 GO:PFM GO:0016765|"GO:transferase activity, transferring alkyl or aryl (other than methyl) groups"|PF01255|IPR001441| RP:SCP:NREP 1 RP:SCP:REP 3->224|1jp3A|9e-73|39.1|207/214|c.101.1.1| HM:SCP:REP 2->224|1jp3A_|3.7e-84|57.0|223/228|c.101.1.1|1/1|Undecaprenyl diphosphate synthase| OP:NHOMO 1389 OP:NHOMOORG 1125 OP:PATTERN 11111111111111111111111112222222111111111112222221222111111111111-11 1221222222222222222-22223222222322222222222223222222222222222222222233211111111111111111111111111--11111111111111111111111111111111111111111111111221111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122211112122111121112221211111111111211211111111112111111-----112221111122111111111111-222222211111111111111111111111111111111111111112111111111------111111111111111111111111111111111112111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111121111-1111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------1------1111111111111 ---1111-21111111111-11111211111112121111111111111111111111111121222212222222222222222211-12-1213111112111111412111111111-11155131BG2-411111-2-121111111111111122111111-121111112222F2222133271992232222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 97.9 SQ:SECSTR TccccEEEEEEccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEccccGGGccHHHHHHHHHHHHHHTTTHHHHHHHTTcEEEEEcccTTccHHHHHHHHHHHHHHTTccccEEEEEccccHHHHHHHHHHHHHHHHHHTcGGGccHHHHHTTcTTTTcccccEEEEcccccccTTcccGGGTTcEEEEccccGGGccHHHHHHHHHHHHHHcHHcT##### DISOP:02AL 231-233| PSIPRED cccccEEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccEEEEccccEEEcccHHHHHHccEEEEcccccccccHHHHHHHHHHHHHHHccccccccc //