[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36475.1
DDBJ      :             antibiotic ABC transporter, transmembrane protein, putative
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  459/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
:256 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->218 PF01061 * ABC2_membrane 5e-19 28.6 %
:HMM:PFM   4->217 PF01061 * ABC2_membrane 4.8e-43 29.0 200/208  
:BLT:SWISS 7->248 YCF38_PORPU 4e-24 26.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36475.1 GT:GENE AAD36475.1 GT:PRODUCT antibiotic ABC transporter, transmembrane protein, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1418638..1419408 GB:FROM 1418638 GB:TO 1419408 GB:DIRECTION + GB:PRODUCT antibiotic ABC transporter, transmembrane protein, putative GB:NOTE similar to GB:AE000782 percent identity: 77.87; identified by sequence similarity; putative GB:PROTEIN_ID AAD36475.1 GB:DB_XREF GI:4981968 LENGTH 256 SQ:AASEQ MAAFVTMIYRQFMRFLRSRSRVIGMIINPLIWIIFFGLGWSKVFDNPWAKMMFGGVDYLTYLAPGIFAMTVFNMSFISGVSLIWDKQFGFFKEVLVAPSSRRLSITGRIVGDAIVTVLQGLIILVFNYFLAESLKISGLLPALAVGFLMSVTIASFGIALALKMESTEGFQMIMMTLMMPLVFLSGAMYPIDSMPNWMKALAYINPLTYAVDASRGYLVGEKVMKFSFGLDWGILSILMLVGLILAMESFERARIS GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 7->248|YCF38_PORPU|4e-24|26.6|237/291| TM:NTM 6 TM:REGION 12->34| TM:REGION 50->72| TM:REGION 106->128| TM:REGION 139->161| TM:REGION 169->191| TM:REGION 231->252| RP:PFM:NREP 1 RP:PFM:REP 5->218|PF01061|5e-19|28.6|206/208|ABC2_membrane| HM:PFM:NREP 1 HM:PFM:REP 4->217|PF01061|4.8e-43|29.0|200/208|ABC2_membrane| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 745 OP:NHOMOORG 520 OP:PATTERN 1111--1111111111211111111---1---1121--1111138-25315551221-1121122-12 12215-------1--11----111-1------11113532222313-1-1--1----1--4----222-41-------1--12-1---1-1-----1----------11----------------11-1-----1211111444122111111111111111121112111111-11111-11-----11-1---------1-----1-1---------11---1------12----1----------1----1-1--1-----11-----------11111------------------------------------------21------1-----1122----1-------1122--2--211--------312--1-----12222111-3112------------22222322411-11111122123312--11131211113--------1---11-2-----------------------------2-1-1-232222222221111122-111111222-212--111121----11-2-23---1-1--------1-212-21-11-----------11-32--222121-211--------------------------121-222111-1111111-111111-1114---2211------111111-1111111111-1111111111111111111121-12122222222222222222211111-1--2--1111--111----111112222111211111-11----11111111111111311112141-1222-21111211111121111-11111-111111222222221111111-11-----------------------------------------1---1-1111-1 -----1-------------------------------1---1-------------------------------------------------------------------------------------------------------------------------1-6-------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 256-257| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //