[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36480.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:716 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->111 2amjA PDBj 6e-04 24.4 %
:RPS:SCOP  417->648 1k1wA3  c.6.2.2 * 9e-04 12.1 %
:RPS:PFM   116->696 PF09960 * DUF2194 2e-83 43.8 %
:HMM:PFM   8->698 PF09960 * DUF2194 2.2e-191 43.5 533/585  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36480.1 GT:GENE AAD36480.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1424197..1426347) GB:FROM 1424197 GB:TO 1426347 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36480.1 GB:DB_XREF GI:4981973 LENGTH 716 SQ:AASEQ MRKFLLLILVLLAFPFFSKTLLLYKGSEGGYGYNILSWLAPEPEVLGEDYEFVDVEKSLPDFEDYDFVITCYYSSSMPGAKKYLKKLVDFLLNGGKLFIINNLGAFEDSSGDNPSLSDINTLLNLLGVSFRYGWRQETVFSYEIEDGYLIKLPSFPVKKAFDGFEVFSSNVKIVSYAVTKKGKHPVIFYGPFGGMALFDHAFNENGEPVVDLRKIVMDIVGGYRENKVLMLDENHHIRKMFEYALFEVDSSRSGVLQKYRAIVIPDVSFLEEKEIKSYLENGGVVILVGSGTHYIQGEVVLEKENLYIPQDITVGERKVGYIPAPENAKAFITISGTPVSWMEKREKGAFVFFPEDLLEKWSRGILFNEFLEASDFVISPMVNAFSVFLDDFPLPAYGIEYDILGTTDEIFYYKIWWRDMKELCEDFSIKPITALVTSYEQKTDYNGFFEFLEKDSSLKVLKNLIEDERVDTGIHGYNHVPPKSENWDLEELGKAYKSLRIFLSQLSSSYEPVAFVAPNNEIDQAGIEVLKSVFPTIKVIGTAYSLKDSTGEFTLLDDALILPRTTSGCYPLQRLLMETVSTLLNLGTYHHFSHPDDVISLDRNPERYSWNEMFDQLRSFFRIMKENYPWLRNMDSKELYNTFKDYFENKPRILYHDKKIVIVLPRTAELPRYFFLKAKGDVNVHGGVILFRDKDLCVVEMREYKMEISEVIEDGR GT:EXON 1|1-716:0| TM:NTM 1 TM:REGION 4->25| SEG 4->17|flllilvllafpff| RP:PDB:NREP 1 RP:PDB:REP 18->111|2amjA|6e-04|24.4|90/174| RP:PFM:NREP 1 RP:PFM:REP 116->696|PF09960|2e-83|43.8|516/571|DUF2194| HM:PFM:NREP 1 HM:PFM:REP 8->698|PF09960|2.2e-191|43.5|533/585|DUF2194| RP:SCP:NREP 1 RP:SCP:REP 417->648|1k1wA3|9e-04|12.1|206/293|c.6.2.2| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1---1----------------------------------------------------------------------------------------------------------------------------1---1---1---------------1------1------------------------------------------------------1-------------------------------1-------1--------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 12.6 SQ:SECSTR #################cEEEEEE#ccccHHHHHHHHHHHHHHHHTTcEEEEEcHHHHHHHHHHccEEEEEEccTcccHH###HHHHHHHHHHHTcTTTcccccccTTccc############################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################# DISOP:02AL 715-716| PSIPRED cHHHHHHHHHHHHHHHHccEEEEEEccccccccHHHHHccccHHHcccccEEEEHHHcccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEcccEEEEcccccHHHHcccHHHHccccEEEEEEEEccccccEEEEcccccHHHHHHHHccccccHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHEEEEccccccccccccEEEEccccHHHHHHHHHHHHcccEEEEEccccHHHcccEEEEEcccEEEccEEEcccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEcHHHHHHHHccHHHHHHHHccccEEEEEEccEEEEEEccccccccccHHHccccHHHHHHHHccHHHHHHHHHccccEEEEEEEEccEEcccccHHHHHccccHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHcccHHHEEEEEEEcccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHEEEcccHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccEEEEEccEEEEEEcccccccEEEEEEEccccEEEccEEEEEcccEEEEEHHHHHHHHHHHHcccc //