[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36482.1
DDBJ      :             helicase-related protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  75/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.92.1
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   111->243 2wjvB PDBj 8e-24 43.6 %
:RPS:PDB   1->65 3d1jA PDBj 1e-05 18.5 %
:RPS:PDB   97->202 3d3xB PDBj 1e-17 7.0 %
:RPS:SCOP  95->203 1t3aA  d.92.1.7 * 3e-19 7.8 %
:HMM:SCOP  96->229 1qhh.1 c.37.1.19 * 1.1e-16 36.2 %
:RPS:PFM   3->88 PF11997 * DUF3492 4e-17 44.2 %
:HMM:PFM   1->73 PF11997 * DUF3492 1.5e-28 41.1 73/268  
:HMM:PFM   159->215 PF01443 * Viral_helicase1 0.00044 23.4 47/226  
:HMM:PFM   116->164 PF09863 * DUF2090 0.00064 30.6 49/311  
:BLT:SWISS 58->238 HCS1_SCHPO 1e-25 42.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36482.1 GT:GENE AAD36482.1 GT:PRODUCT helicase-related protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1427297..1428034 GB:FROM 1427297 GB:TO 1428034 GB:DIRECTION + GB:PRODUCT helicase-related protein GB:NOTE similar to GB:Pyro_h percent identity: 82.80; identified by sequence similarity; putative GB:PROTEIN_ID AAD36482.1 GB:DB_XREF GI:4981975 LENGTH 245 SQ:AASEQ MRVGLIAEGTYPYITGGVSSWIQTLISNLPEFEFEIYHLRPDSKKREVRYKIPKNVVRIHEVNIFGDFDPEIPEEANLSALTEITKAIVLSPKNVLVFIDTKNRSDRFERQRKDSPSRENPLEAQIVKEVVEKLLSMGVKEDWIGIITPYDDQVNLIRELIEAKVEVHSVDGFQGREKEVIIISFVRSNKNGEIGFLEDLRRLNVSLTRAKRKLIATGDSSTLSVHPTYRRFVEFVKKKGTYVIF GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 58->238|HCS1_SCHPO|1e-25|42.4|177/660| BL:PDB:NREP 1 BL:PDB:REP 111->243|2wjvB|8e-24|43.6|133/768| RP:PDB:NREP 2 RP:PDB:REP 1->65|3d1jA|1e-05|18.5|65/475| RP:PDB:REP 97->202|3d3xB|1e-17|7.0|100/407| RP:PFM:NREP 1 RP:PFM:REP 3->88|PF11997|4e-17|44.2|86/262|DUF3492| HM:PFM:NREP 3 HM:PFM:REP 1->73|PF11997|1.5e-28|41.1|73/268|DUF3492| HM:PFM:REP 159->215|PF01443|0.00044|23.4|47/226|Viral_helicase1| HM:PFM:REP 116->164|PF09863|0.00064|30.6|49/311|DUF2090| RP:SCP:NREP 1 RP:SCP:REP 95->203|1t3aA|3e-19|7.8|102/400|d.92.1.7| HM:SCP:REP 96->229|1qhh.1|1.1e-16|36.2|116/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1477 OP:NHOMOORG 302 OP:PATTERN --------------1-1------22221111111111-11111----------12121111------- -----------------------------------------1-1----------------1----------1----------11-2--2222-1-----------11111------------------------------1----1-1----------------1----11-----------------------------1---1---1------------1--------11--------------------------------------------------------------------------------------1-------1---------1-------------------------1--------1---1-------------------1----------------------------------------------------------------------------------------------------------------1--------------------1--------1-----11-------------------------------1---1-------------11111----------------1--------21-----1------1-------------------------------------1----------------------------------1----------------------------------------------------------1---------------------------1------1-1----------------------1--------------------------21111111------------------------------------1--222-331--- 4411D55161123265576565747455564545855424443444665367363345453555554525545425514555555666-AFC5G69534265554626K3O6A4AB75654797ED395M*85A7C2654A678746612A53C6B9967584B5E4B4C984C14959mC6B647DBK4HC6B57838 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 89.4 SQ:SECSTR cEEEEEccccTTTcccTHHHHHHHHHHHHHHTTcEEEEEEEccHHHHTTcTTcEEEEEEccTTccEEE######################ccHHHHHHHHHT##HHTTEEEcTTccEEEcHHHHHHHHHHHHHccHHHHHHHHcccccccEEEEcccTTcTTTcccGGGGGGGGGGcTTTcGGGccccccccTHHHHHHcccHHHHHTTEEEEEEEEEccccGGGTTccGGGcEEccHTTcEE## DISOP:02AL 109-116| PSIPRED cEEEEEEEccEEEEEEcccHHHHHHHHccccccEEEEEEcccccEEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccccEEEEcccccEEcHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHcccccEEEcccccccccccEEEEEEEEccccccccccccccEEEHEEHHHcccEEEEEcHHHHHccHHHHHHHHHHHHcccEEEc //