[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36499.1
DDBJ      :             glycerol uptake facilitator protein
Swiss-Prot:GLPF_THEMA   RecName: Full=Probable glycerol uptake facilitator protein;

Homologs  Archaea  22/68 : Bacteria  503/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
f.19.1
:234 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->214 3c02A PDBj 1e-27 37.2 %
:RPS:PDB   56->233 2b5fD PDBj 2e-21 21.3 %
:RPS:PDB   58->76 2b5fA PDBj 8e-06 72.2 %
:RPS:SCOP  5->234 1fx8A  f.19.1.1 * 5e-46 38.3 %
:HMM:SCOP  1->236 1fx8A_ f.19.1.1 * 7.2e-72 46.8 %
:RPS:PFM   1->230 PF00230 * MIP 4e-44 54.8 %
:HMM:PFM   4->230 PF00230 * MIP 4.1e-56 36.2 210/227  
:BLT:SWISS 1->234 GLPF_THEMA e-130 100.0 %
:PROS 62->70|PS00221|MIP
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36499.1 GT:GENE AAD36499.1 GT:PRODUCT glycerol uptake facilitator protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1445404..1446108 GB:FROM 1445404 GB:TO 1446108 GB:DIRECTION + GB:PRODUCT glycerol uptake facilitator protein GB:NOTE similar to GB:M99611 SP:P18156 PID:142991 PID:142997 PID:2226136 percent identity: 79.91; identified by sequence similarity; putative GB:PROTEIN_ID AAD36499.1 GB:DB_XREF GI:4981994 LENGTH 234 SQ:AASEQ MSVYLAEFLGTMLLIILGDGVVANVVLKKSKGHNSGWIVITTGWGLAVAMSVYLVGRISGAHINPAVTIGLAFIGQFPWSKVPGYIFSQILGAFVGAILVYLTYLPHWKETDDPDAKLAVFCTGPAVRKYGANLLTEIIGTMVLLMGVLGIGANKLADGLNPLLVGFLVWSIGLSLGGPTGYAINPARDFGPRLAHAILPIPGKRDSDWSYSWVPIIGPIIGGILGASLYNWLF GT:EXON 1|1-234:0| SW:ID GLPF_THEMA SW:DE RecName: Full=Probable glycerol uptake facilitator protein; SW:GN Name=glpF; OrderedLocusNames=TM_1429; SW:KW Cell membrane; Complete proteome; Glycerol metabolism; Membrane;Repeat; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->234|GLPF_THEMA|e-130|100.0|234/234| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006071|"GO:glycerol metabolic process"|Glycerol metabolism| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 62->70|PS00221|MIP|PDOC00193| TM:NTM 6 TM:REGION 4->26| TM:REGION 45->67| TM:REGION 84->105| TM:REGION 119->141| TM:REGION 143->165| TM:REGION 211->233| SEG 215->224|piigpiiggi| BL:PDB:NREP 1 BL:PDB:REP 4->214|3c02A|1e-27|37.2|199/242| RP:PDB:NREP 2 RP:PDB:REP 56->233|2b5fD|2e-21|21.3|164/230| RP:PDB:REP 58->76|2b5fA|8e-06|72.2|18/236| RP:PFM:NREP 1 RP:PFM:REP 1->230|PF00230|4e-44|54.8|219/227|MIP| HM:PFM:NREP 1 HM:PFM:REP 4->230|PF00230|4.1e-56|36.2|210/227|MIP| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00230|IPR000425| GO:PFM GO:0006810|"GO:transport"|PF00230|IPR000425| GO:PFM GO:0016020|"GO:membrane"|PF00230|IPR000425| RP:SCP:NREP 1 RP:SCP:REP 5->234|1fx8A|5e-46|38.3|227/254|f.19.1.1| HM:SCP:REP 1->236|1fx8A_|7.2e-72|46.8|233/254|f.19.1.1|1/1|Aquaporin-like| OP:NHOMO 1599 OP:NHOMOORG 683 OP:PATTERN -------1-111111--------1---1----111---11111111-1---1---------------- 1221211-----1-2----------3-------11112------21111121111122--11-1112322-1111111---11----------1----------11-1-2--------------111---------11111----1---11------------11-2----------------111----1--111111121111211111111111111111212222221-111111111111111111133231221111155112243322144333331123113333333333323223222322323331113333---211111111212----2222-1-11---1--1-1----1-211--1-2-2---------3-1-----1-1----1-----1---1121111111------11-----111-1-1--1111--1111111111221------------------------------------11--11--22222212222222-222222222---1----------1---1--1--1--2---------------------1-11111-1-11--------11------------------------------2221-----1------------1--1-1----1----1--11122111111111111121-1111121111112111112333112212222222222222212111111121-211111111111------------------111212-12-21--1111111----2-11211221-22211111111111111-2222-1111121221111111---1111---111111111111111---------1-1111111111111-----------1----- 11--1-1-313-22267234223434311-1-1111111111111154343313224-----2--122--21-1-22-121--------622721511--2-2122-241FCDAEA54455565D96A6Eh7-9792764747663643464267658811-78961325E5851-11-----31ECSV1SD1-OIUX- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcHHHHHHHHHHHHHHHHHHHTTTTcccccHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccTTHHcGGGcccccTTcHHHHHHHHHHHHHHHHHHHHHTEEcccccEEccHHHHHHHHHHHHHHTTTTcccccHHHHHHHHHHHcHHHcTHHcHHHHHHTTHHHHHHHHHHHHHHHHHHHcT PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHc //