[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36507.1
DDBJ      :             dimethyladenosine transferase
Swiss-Prot:KSGA_THEMA   RecName: Full=Dimethyladenosine transferase;         EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase;

Homologs  Archaea  56/68 : Bacteria  907/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->275 3fycA PDBj 1e-32 37.1 %
:RPS:PDB   27->209 3a25A PDBj 6e-22 21.9 %
:RPS:SCOP  39->268 1qyrA  c.66.1.24 * 2e-56 31.7 %
:HMM:SCOP  22->273 1i4wA_ c.66.1.24 * 2.3e-73 43.2 %
:RPS:PFM   34->266 PF00398 * RrnaAD 6e-49 48.7 %
:HMM:PFM   32->264 PF00398 * RrnaAD 3.4e-60 37.8 233/262  
:BLT:SWISS 1->279 KSGA_THEMA e-160 100.0 %
:PROS 63->90|PS01131|RRNA_A_DIMETH

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36507.1 GT:GENE AAD36507.1 GT:PRODUCT dimethyladenosine transferase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1452136..1452975) GB:FROM 1452136 GB:TO 1452975 GB:DIRECTION - GB:PRODUCT dimethyladenosine transferase GB:NOTE similar to GB:D26185 SP:P37468 PID:467431 GB:AL009126 percent identity: 63.98; identified by sequence similarity; putative GB:PROTEIN_ID AAD36507.1 GB:DB_XREF GI:4982002 LENGTH 279 SQ:AASEQ MDGCHLSRDKLQGDGEGCDLKTSDYLKKYGVRLKKHLGQVFLSDDRIAKRIVKAAELTPEDVVVEIGAGAGTLTEELAKTGARVIAYEIDESLAPILQERLSKYPNVELRFEDFLKAKNVPEGAICVSNIPYNITGPLMEKIIEWKFKRAIVMIQKEVGERILAKPGKKTYGYLSVVVQTFYEVKKLFDVSRSCFVPNPEVDSTVVDLKRKPVDLDFEKFKKFVSMIFAKKRKTLKNNLRPFLSIFEGVDLSRRAEQLTVEEIVELYEKWRRALECSRG GT:EXON 1|1-279:0| SW:ID KSGA_THEMA SW:DE RecName: Full=Dimethyladenosine transferase; EC=2.1.1.-;AltName: Full=S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase;AltName: Full=16S rRNA dimethylase;AltName: Full=High level kasugamycin resistance protein ksgA;AltName: Full=Kasugamycin dimethyltransferase; SW:GN Name=ksgA; OrderedLocusNames=TM_1437; SW:KW Antibiotic resistance; Complete proteome; Methyltransferase;RNA-binding; rRNA processing; S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->279|KSGA_THEMA|e-160|100.0|279/279| GO:SWS:NREP 5 GO:SWS GO:0046677|"GO:response to antibiotic"|Antibiotic resistance| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 63->90|PS01131|RRNA_A_DIMETH|PDOC00871| BL:PDB:NREP 1 BL:PDB:REP 39->275|3fycA|1e-32|37.1|237/265| RP:PDB:NREP 1 RP:PDB:REP 27->209|3a25A|6e-22|21.9|178/264| RP:PFM:NREP 1 RP:PFM:REP 34->266|PF00398|6e-49|48.7|232/256|RrnaAD| HM:PFM:NREP 1 HM:PFM:REP 32->264|PF00398|3.4e-60|37.8|233/262|RrnaAD| GO:PFM:NREP 3 GO:PFM GO:0000154|"GO:rRNA modification"|PF00398|IPR001737| GO:PFM GO:0000179|"GO:rRNA (adenine-N6,N6-)-dimethyltransferase activity"|PF00398|IPR001737| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF00398|IPR001737| RP:SCP:NREP 1 RP:SCP:REP 39->268|1qyrA|2e-56|31.7|230/252|c.66.1.24| HM:SCP:REP 22->273|1i4wA_|2.3e-73|43.2|250/0|c.66.1.24|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1312 OP:NHOMOORG 1150 OP:PATTERN --11111---------1111111111111111111111111111111111111111111111111-11 1111211111111111111-1111111111111111211111-11111111111111111121111212111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111112111111111123613111123331111421211111111111111111111111111111111111111422111111111111121111111111211111211111111111113111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 22-1221-41112211111111111111111111111111111-1-1111111111111111111111111111111-1111111111-1211111111111122212-2432213-222112222122272-2222-123123122212212312222--121221423142222122F2221232331322232223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 100.0 SQ:SECSTR cGGGGTTTcccEEEEEEETcHHHHHHEETTEEEEEETTTccccGGGHHHHHHHHHHccTTcEEEETTcTTTTTHHHHHHHTcEEEEEcccHHHHHHHHHHHHHTTTEEEEcccGGGccccccEEEEEEccccccGGGGHHHHHHHEEEEEEEEEEEcccGGGTTTTTHHHHHHHHHHHTTTcEEEEEEEEEccccccccccccEEEEEEEccGGGcccccEEEEEETTTccGGGGcEHHHHHHHHTTTcccEEEEcccccccccccccccTTEEEEEEc DISOP:02AL 1-5, 7-23, 278-279| PSIPRED cccEEEccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHccccEEEEEccHHHcccccccEEEEEcccccccHHHHHHHHHcccccEEEEEEEHHHHHHEEccccccccHHHHHHHHHcccEEEEEEccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcc //