[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36523.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  94/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->110 PF09515 * Thia_YuaJ 3e-09 38.4 %
:HMM:PFM   3->147 PF07155 * DUF1393 1.5e-09 20.7 140/169  
:HMM:PFM   142->166 PF11755 * DUF3311 0.00094 24.0 25/66  
:BLT:SWISS 16->167 YPAA_BACSU 7e-09 26.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36523.1 GT:GENE AAD36523.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1471820..1472371) GB:FROM 1471820 GB:TO 1472371 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to PID:1146197 SP:P50726 GB:AL009126 percent identity: 56.73; identified by sequence similarity; putative GB:PROTEIN_ID AAD36523.1 GB:DB_XREF GI:4982020 LENGTH 183 SQ:AASEQ MSSIKKISFVGIFSALATLVMFLEFPIFPQASFLKYDPSEIPALIVSFLLGPGVGMFVVLVKDILFFLMKSGDPVGIAMNAVLGMSFVGIAGLIYHRNKSRATAIKGMIVATLFATAFALGLNALIVPLYFEAPFELYLKFFPFILAFNLVKFGIDSVVTFFVYKKVSSILKLETVEGRSNNG GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 16->167|YPAA_BACSU|7e-09|26.3|152/100| TM:NTM 5 TM:REGION 7->29| TM:REGION 44->66| TM:REGION 75->97| TM:REGION 107->129| TM:REGION 141->163| SEG 111->125|atlfatafalglnal| RP:PFM:NREP 1 RP:PFM:REP 10->110|PF09515|3e-09|38.4|99/177|Thia_YuaJ| HM:PFM:NREP 2 HM:PFM:REP 3->147|PF07155|1.5e-09|20.7|140/169|DUF1393| HM:PFM:REP 142->166|PF11755|0.00094|24.0|25/66|DUF3311| OP:NHOMO 96 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------11111111121----------------------------------------------------------------------------------------------------------11---1-----------------111----1---1---111111--11111111111111-1111-----------------1------------1111--------------------------1--1111---111-11111112-111111111111-11-11--------11--1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 173-183| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //