[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36539.1
DDBJ      :             ribosomal protein L17
Swiss-Prot:RL17_THEMA   RecName: Full=50S ribosomal protein L17;

Homologs  Archaea  0/68 : Bacteria  147/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.188.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->125 1vsaL PDBj 9e-13 35.9 %
:RPS:PDB   1->124 3bboP PDBj 1e-20 29.3 %
:RPS:SCOP  15->125 1gd8A  d.188.1.1 * 7e-14 35.0 %
:HMM:SCOP  14->125 1gd8A_ d.188.1.1 * 9.9e-29 42.3 %
:RPS:PFM   20->124 PF01196 * Ribosomal_L17 5e-06 34.0 %
:HMM:PFM   20->124 PF01196 * Ribosomal_L17 2.9e-31 48.5 97/97  
:BLT:SWISS 1->131 RL17_THEMA 1e-54 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36539.1 GT:GENE AAD36539.1 GT:PRODUCT ribosomal protein L17 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1483648..1484043) GB:FROM 1483648 GB:TO 1484043 GB:DIRECTION - GB:PRODUCT ribosomal protein L17 GB:NOTE similar to GB:AE000511 SP:P56042 PID:2314458 percent identity: 64.96; identified by sequence similarity; putative GB:PROTEIN_ID AAD36539.1 GB:DB_XREF GI:4982037 LENGTH 131 SQ:AASEQ MRHRVKRHKLGRYGSHRKSLLRNLSREIVEHGSIVTTTAKAKALKTFMDKLVSKAIEAATTDDRARSVHLRRQINAVLGDRRLTNKLVDEIAKNYVGRRGGYVRVLRIGFRRGDAAEMSLVQLVEASSQEG GT:EXON 1|1-131:0| SW:ID RL17_THEMA SW:DE RecName: Full=50S ribosomal protein L17; SW:GN Name=rplQ; OrderedLocusNames=TM_1471; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|RL17_THEMA|1e-54|100.0|131/131| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 36->46|tttakakalkt| SEG 95->105|yvgrrggyvrv| BL:PDB:NREP 1 BL:PDB:REP 1->125|1vsaL|9e-13|35.9|117/118| RP:PDB:NREP 1 RP:PDB:REP 1->124|3bboP|1e-20|29.3|116/116| RP:PFM:NREP 1 RP:PFM:REP 20->124|PF01196|5e-06|34.0|97/97|Ribosomal_L17| HM:PFM:NREP 1 HM:PFM:REP 20->124|PF01196|2.9e-31|48.5|97/97|Ribosomal_L17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01196|IPR000456| GO:PFM GO:0005622|"GO:intracellular"|PF01196|IPR000456| GO:PFM GO:0005840|"GO:ribosome"|PF01196|IPR000456| GO:PFM GO:0006412|"GO:translation"|PF01196|IPR000456| RP:SCP:NREP 1 RP:SCP:REP 15->125|1gd8A|7e-14|35.0|103/105|d.188.1.1| HM:SCP:REP 14->125|1gd8A_|9.9e-29|42.3|104/105|d.188.1.1|1/1|Prokaryotic ribosomal protein L17| OP:NHOMO 151 OP:NHOMOORG 149 OP:PATTERN -------------------------------------------------------------------- 1-111--------------------------------------------------------------111------------1-------------1--1---1-1-111-----------------------------------11-1-------------------------------------1111---------------------------------------------------------------------------------------------------------------------------------------1-----------------------1----1-------1--1----1-11--1---11111-------------11111111111---------1111111111111111--111----------11111111111-1--1-1-------1--------------------11-------------------------------------------------------11---1---------------111111---11---------1-1111--1-11-11111111---------111-1-----------------------------------11---------------------------------------------------------------------------------------------------------------------------------------1-----------------1111111111----------------------------1---------11111111----------------------------11111111111-- ------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 98.5 SQ:SECSTR ccTTcccccTTccGGGHHHHHHHHHHHHHHTccEEEcHHHHHHHHHHHHHHHHHHHHcTTcHHHHHTTHHHHHHHTTcccTTHHHHHTTccGGGGcccccccEEccccccccccccccEEEEEcccccc## DISOP:02AL 1-5, 7-12, 128-131| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEEEccccccc //