[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36557.1
DDBJ      :             ribosomal protein S17
Swiss-Prot:RS17_THEMA   RecName: Full=30S ribosomal protein S17;

Homologs  Archaea  10/68 : Bacteria  895/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->79 1vs7Q PDBj 7e-27 61.8 %
:RPS:PDB   2->79 3d5aQ PDBj 1e-25 60.3 %
:RPS:SCOP  2->107 1fjgQ  b.40.4.5 * 5e-28 50.0 %
:HMM:SCOP  2->82 1ripA_ b.40.4.5 * 6.7e-33 66.7 %
:RPS:PFM   8->76 PF00366 * Ribosomal_S17 7e-22 78.3 %
:HMM:PFM   8->76 PF00366 * Ribosomal_S17 7.8e-37 75.4 69/69  
:BLT:SWISS 1->107 RS17_THEMA 2e-58 100.0 %
:PROS 54->66|PS00056|RIBOSOMAL_S17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36557.1 GT:GENE AAD36557.1 GT:PRODUCT ribosomal protein S17 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1493596..1493919) GB:FROM 1493596 GB:TO 1493919 GB:DIRECTION - GB:PRODUCT ribosomal protein S17 GB:NOTE similar to SP:P38519 PID:437932 GB:AE000512 percent identity: 99.07; identified by sequence similarity; putative GB:PROTEIN_ID AAD36557.1 GB:DB_XREF GI:4982055 LENGTH 107 SQ:AASEQ MPRKRLTGIVVSDKMDKTVVVAVEKLVQHPLYKKYVKRTKKYHAHDERNECKIGDVVEIEETRPLSKTKRWRVVRIIQRFEPERVVKEKEDIQEEIEAVEGKGGVES GT:EXON 1|1-107:0| SW:ID RS17_THEMA SW:DE RecName: Full=30S ribosomal protein S17; SW:GN Name=rpsQ; OrderedLocusNames=TM_1491; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->107|RS17_THEMA|2e-58|100.0|107/107| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 54->66|PS00056|RIBOSOMAL_S17|PDOC00055| BL:PDB:NREP 1 BL:PDB:REP 4->79|1vs7Q|7e-27|61.8|76/81| RP:PDB:NREP 1 RP:PDB:REP 2->79|3d5aQ|1e-25|60.3|78/99| RP:PFM:NREP 1 RP:PFM:REP 8->76|PF00366|7e-22|78.3|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 8->76|PF00366|7.8e-37|75.4|69/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 2->107|1fjgQ|5e-28|50.0|104/104|b.40.4.5| HM:SCP:REP 2->82|1ripA_|6.7e-33|66.7|81/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1014 OP:NHOMOORG 966 OP:PATTERN -------------------------11----------------1---111111-----1--------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111-11111111111112-11111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-1-------11111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 --------211------------------11-1----111-11111--11--------1------1121111-1-1--1-1-----33-22--111---11-1-13---------------------------------------------------------------------21-1G122223233-32111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 96.3 SQ:SECSTR #cccEEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEcccHHHHHHHHHHHHHHHTTccTTcc### DISOP:02AL 83-107| PSIPRED cccEEEEEEEEEcccccEEEEEEEEEEEccEEcEEEEEcccEEEEccccEEccccEEEEEEccccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccccc //