[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36558.1
DDBJ      :             ribosomal protein L29
Swiss-Prot:RL29_THESQ   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->66 1r73A PDBj 1e-24 100.0 %
:RPS:PDB   1->63 3d5b2 PDBj 9e-09 34.9 %
:RPS:SCOP  1->63 1vs6X1  a.2.2.1 * 1e-11 38.1 %
:HMM:SCOP  1->66 1r73A_ a.2.2.1 * 3.7e-19 54.5 %
:HMM:PFM   3->60 PF00831 * Ribosomal_L29 1.9e-26 55.2 58/58  
:BLT:SWISS 1->66 RL29_THESQ 1e-24 100.0 %
:PROS 39->53|PS00579|RIBOSOMAL_L29
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36558.1 GT:GENE AAD36558.1 GT:PRODUCT ribosomal protein L29 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1493924..1494124) GB:FROM 1493924 GB:TO 1494124 GB:DIRECTION - GB:PRODUCT ribosomal protein L29 GB:NOTE similar to SP:P38514 PID:437931 GB:AE000512 percent identity: 100.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD36558.1 GB:DB_XREF GI:4982056 LENGTH 66 SQ:AASEQ MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRERELGIRR GT:EXON 1|1-66:0| SW:ID RL29_THESQ SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=TRQ2_1386; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|RL29_THESQ|1e-24|100.0|66/66| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 39->53|PS00579|RIBOSOMAL_L29|PDOC00501| SEG 12->22|eelknlleekk| BL:PDB:NREP 1 BL:PDB:REP 1->66|1r73A|1e-24|100.0|66/66| RP:PDB:NREP 1 RP:PDB:REP 1->63|3d5b2|9e-09|34.9|63/72| HM:PFM:NREP 1 HM:PFM:REP 3->60|PF00831|1.9e-26|55.2|58/58|Ribosomal_L29| RP:SCP:NREP 1 RP:SCP:REP 1->63|1vs6X1|1e-11|38.1|63/63|a.2.2.1| HM:SCP:REP 1->66|1r73A_|3.7e-19|54.5|66/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 64 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- -------------1------------------------------1------------------------1---------------------------------------------------------------------11--------------------------------------------------11111111-11111111111111111-111-111------111-----------------------------------------------------------------------------------------11--------------1----------1----1--1111111-111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 100.0 SQ:SECSTR HHHHTTTTcTHHHHHHHHHHHHHHHHHHHHHHHHcTTccTTHHHHHHHHHHHHHHHHHHHHHHTTc DISOP:02AL 36-37, 64-66| PSIPRED ccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccc //