[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36565.1
DDBJ      :             ribosomal protein L4
Swiss-Prot:RL4_THEMA    RecName: Full=50S ribosomal protein L4;AltName: Full=TmaL4;

Homologs  Archaea  0/68 : Bacteria  901/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
c.22.1
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->226 1dmgA PDBj 7e-81 100.0 %
:RPS:PDB   2->226 1dmgA PDBj 6e-30 91.9 %
:RPS:SCOP  2->226 1dmgA  c.22.1.1 * 2e-30 91.9 %
:HMM:SCOP  2->226 1dmgA_ c.22.1.1 * 8.1e-80 56.3 %
:RPS:PFM   17->224 PF00573 * Ribosomal_L4 4e-44 54.2 %
:HMM:PFM   18->223 PF00573 * Ribosomal_L4 2.9e-76 59.6 188/192  
:BLT:SWISS 1->235 RL4_THEMA e-128 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36565.1 GT:GENE AAD36565.1 GT:PRODUCT ribosomal protein L4 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1497113..1497820) GB:FROM 1497113 GB:TO 1497820 GB:DIRECTION - GB:PRODUCT ribosomal protein L4 GB:NOTE similar to SP:P38516 PID:437924 GB:AE000512 percent identity: 99.15; identified by sequence similarity; putative GB:PROTEIN_ID AAD36565.1 GB:DB_XREF GI:4982063 LENGTH 235 SQ:AASEQ MAQVDLLNVKGEKVGTLEISDFVFNIDPNYDVMWRYVDMQLSNRRAGTASTKTRGEVSGGGRKPWPQKHTGRARHGSIRSPIWRHGGVVHGPKPRDWSKKLNKKMKKLALRSALSVKYRENKLLVLDDLKLERPKTKSLKEILQNLQLSDKKTLIVLPWKEEGYMNVKLSGRNLPDVKVIIADNPNNSKNGEKAVRIDGLNVFDMLKYDYLVLTRDMVSKIEEVLGNEAGKALTA GT:EXON 1|1-235:0| SW:ID RL4_THEMA SW:DE RecName: Full=50S ribosomal protein L4;AltName: Full=TmaL4; SW:GN Name=rplD; OrderedLocusNames=TM_1499; SW:KW 3D-structure; Complete proteome; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|RL4_THEMA|e-128|100.0|235/235| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 99->110|kklnkkmkklal| BL:PDB:NREP 1 BL:PDB:REP 2->226|1dmgA|7e-81|100.0|172/172| RP:PDB:NREP 1 RP:PDB:REP 2->226|1dmgA|6e-30|91.9|172/172| RP:PFM:NREP 1 RP:PFM:REP 17->224|PF00573|4e-44|54.2|190/190|Ribosomal_L4| HM:PFM:NREP 1 HM:PFM:REP 18->223|PF00573|2.9e-76|59.6|188/192|Ribosomal_L4| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00573|IPR002136| GO:PFM GO:0005622|"GO:intracellular"|PF00573|IPR002136| GO:PFM GO:0005840|"GO:ribosome"|PF00573|IPR002136| GO:PFM GO:0006412|"GO:translation"|PF00573|IPR002136| RP:SCP:NREP 1 RP:SCP:REP 2->226|1dmgA|2e-30|91.9|172/172|c.22.1.1| HM:SCP:REP 2->226|1dmgA_|8.1e-80|56.3|222/225|c.22.1.1|1/1|Ribosomal protein L4| OP:NHOMO 1120 OP:NHOMOORG 1050 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111-111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111-11111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111112111111111111111111-11111111111111111111111111111-11 ----111-----1-111111111111111-1111111111-111111111111111111111-11-------11------1-----11-1211111---1-11112-1-123111111-1-11121111363-111-11111111-11--1--11--11111121-1111911212222I2222143531321121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 97.4 SQ:SECSTR cEEEEccccccccccEEEEccccccccccTTTTTTHHHHHHHHHccccccccccTTcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHTTccccccGGGTTccccHHHHTTHHHHcccccccccEEcccccGGGcccTTTccccccEEccccccccccccccccccccccHHHHHHcccEEccTTHHHHHHHHccHHc###### DISOP:02AL 44-77, 232-235| PSIPRED ccEEEEEcccccEEEEEEccHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEccHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHcccccEEEEEcccccHHHHcccccccccccHHHHHHcccEEEEHHHHHHHHHHHHHHHcccccc //