[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36591.1
DDBJ      :             endoglucanase
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.29.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->206 1h0bA PDBj 6e-11 30.5 %
:RPS:SCOP  63->255 1h0bA  b.29.1.11 * 2e-35 28.4 %
:HMM:SCOP  3->258 1h0bA_ b.29.1.11 * 3.3e-58 33.2 %
:RPS:PFM   86->253 PF01670 * Glyco_hydro_12 3e-11 34.9 %
:HMM:PFM   82->255 PF01670 * Glyco_hydro_12 7.1e-61 46.5 155/156  
:BLT:SWISS 63->204 GUNS_PECCC 6e-08 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36591.1 GT:GENE AAD36591.1 GT:PRODUCT endoglucanase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1520610..1521386 GB:FROM 1520610 GB:TO 1521386 GB:DIRECTION + GB:PRODUCT endoglucanase GB:NOTE similar to PID:1297061 GB:AE000512 percent identity: 100.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD36591.1 GB:DB_XREF GI:4982091 LENGTH 258 SQ:AASEQ MVVLMTKPGTSDFVWNGIPLSMELNLWNIKEYSGSVAMKFDGEKITFDADIQNLSPKEPERYVLGYPEFYYGYKPWENHTAEGSKLPVPVSSMKSFSVEVSFDIHHEPSLPLNFAMETWLTREKYQTEASIGDVEIMVWFYFNNLTPGGEKIEEFTIPFVLNGESVEGTWELWLAEWGWDYLAFRLKDPVKKGRVKFDVRHFLDAAGKALSSSARVKDFEDLYFTVWEIGTEFGSPETKSAQFGWKFENFSIDLEVRE GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 63->204|GUNS_PECCC|6e-08|30.8|133/100| BL:PDB:NREP 1 BL:PDB:REP 63->206|1h0bA|6e-11|30.5|131/226| RP:PFM:NREP 1 RP:PFM:REP 86->253|PF01670|3e-11|34.9|146/153|Glyco_hydro_12| HM:PFM:NREP 1 HM:PFM:REP 82->255|PF01670|7.1e-61|46.5|155/156|Glyco_hydro_12| GO:PFM:NREP 2 GO:PFM GO:0000272|"GO:polysaccharide catabolic process"|PF01670|IPR002594| GO:PFM GO:0008810|"GO:cellulase activity"|PF01670|IPR002594| RP:SCP:NREP 1 RP:SCP:REP 63->255|1h0bA|2e-35|28.4|169/226|b.29.1.11| HM:SCP:REP 3->258|1h0bA_|3.3e-58|33.2|226/227|b.29.1.11|1/1|Concanavalin A-like lectins/glucanases| OP:NHOMO 31 OP:NHOMOORG 16 OP:PATTERN --------2222223-14-------------------------------------1------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 53.1 SQ:SECSTR ##############################################################cccccEEEEEEEcTTEEcTTTccccEEGGGEEEEEEEEEEEEEcccccEEEEEEEEEEEcccccTTccTTcEEEEEEEEEETcccccEEEEEEEE######EETTEEEEEEEEEcccEEEEEEEcccccEEE#EEEHHHHHHHH#################################################### DISOP:02AL 258-259| PSIPRED cEEEEEccccccEEEcccEEEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEccccccccccEEEEccccccccccccccccEEEcccccEEEEEEEEEEccccEEEEEEEEEEEcccccccccccccEEEEEEEEccccccccEEEEEEEEEEEEEccccccEEEEEEcccccEEEEEEccccccEEEEEEEHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEccccccEEEEEEEEEEEEEEEEEEc //