[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36600.1
DDBJ      :             ferredoxin
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  140/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->89 2gmhB PDBj 1e-08 37.8 %
:RPS:PDB   33->84 1bc6A PDBj 4e-06 28.8 %
:RPS:SCOP  11->83 1ti2B2  d.58.1.5 * 5e-07 20.5 %
:HMM:SCOP  33->92 2gmhA3 d.58.1.6 * 1.5e-15 38.3 %
:HMM:PFM   14->51 PF05187 * ETF_QO 1.5e-08 36.8 38/110  
:HMM:PFM   56->77 PF00037 * Fer4 3.6e-07 50.0 22/24  
:BLT:SWISS 2->92 FIXX_AZOVI 6e-25 51.1 %
:PROS 61->72|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36600.1 GT:GENE AAD36600.1 GT:PRODUCT ferredoxin GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1527959..1528237 GB:FROM 1527959 GB:TO 1528237 GB:DIRECTION + GB:PRODUCT ferredoxin GB:NOTE similar to GB:X65515 PID:510488 SP:P53658 percent identity: 68.82; identified by sequence similarity; putative GB:PROTEIN_ID AAD36600.1 GB:DB_XREF GI:4982100 LENGTH 92 SQ:AASEQ MRIEDKLYLNRYRTDEENPHLKIKDESICAEKCSDRPCVSCCPADVYEWTESGMEVKFEGCLECGTCRIVCPFGNIEWNYPRGNYGVLYKFG GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 2->92|FIXX_AZOVI|6e-25|51.1|90/94| PROS 61->72|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 1 BL:PDB:REP 16->89|2gmhB|1e-08|37.8|74/578| RP:PDB:NREP 1 RP:PDB:REP 33->84|1bc6A|4e-06|28.8|52/77| HM:PFM:NREP 2 HM:PFM:REP 14->51|PF05187|1.5e-08|36.8|38/110|ETF_QO| HM:PFM:REP 56->77|PF00037|3.6e-07|50.0|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 11->83|1ti2B2|5e-07|20.5|73/195|d.58.1.5| HM:SCP:REP 33->92|2gmhA3|1.5e-15|38.3|60/0|d.58.1.6|1/1|4Fe-4S ferredoxins| OP:NHOMO 265 OP:NHOMOORG 160 OP:PATTERN ------2222222222-111111------1-------------------------------211---- -1-----------------------------------------------------------------------------132----------------------------------------------1-1--------11----1----------------------------------------------1---------------------------1----------1------------------------------------------------------------------------------------------------------------11--------------5422311111-----1-------------11122-1-11111--------------1--2---1------11111-1111-1--------------------11---11----------------------------------1-------------------1-------11---------1-----1--------------------------1-1------------------1---------1-------------------------11------------------1----1-11-1--------------2-1-1--3333333232-3333333333333333331-------12121222222212112-2233332---------------------------------------------------------1--------------------------------------------11111111-------------------------------------------------------1-1111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 85.9 SQ:SECSTR ##########EEEEEcccccEEcccTTHHHHTccccccTTTcTTccEEEccccEEEcTTTccccccHHHHcGGGccEETTTccHccccc### DISOP:02AL 92-93| PSIPRED ccHHHHHcccccEEccccccEEEccccccccccccccHHHccccccEEEEccEEEEEcccccccccccEEccccccEEEccccccccccccc //