[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36605.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->75 PF10135 * Rod-binding 2.1e-09 32.6 46/49  
:BLT:SWISS 6->86 DAPE_STAAN 9e-05 30.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36605.1 GT:GENE AAD36605.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1531421..1531690) GB:FROM 1531421 GB:TO 1531690 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36605.1 GB:DB_XREF GI:4982105 LENGTH 89 SQ:AASEQ MFVYGVSSNIKNLRDASIEFVSDLFYRIFKEMYESIPKYDLVPETTAEKWFKEMLLQEYSKHAAEQSPLADMVMKSLGGKKISSLPQRK GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 6->86|DAPE_STAAN|9e-05|30.0|80/407| HM:PFM:NREP 1 HM:PFM:REP 30->75|PF10135|2.1e-09|32.6|46/49|Rod-binding| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7, 85-89| PSIPRED cEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHcccccc //