[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36620.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.114.1
:106 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  19->93 1m1gA1  b.114.1.1 * 1e-15 26.4 %
:RPS:PFM   17->96 PF07009 * DUF1312 6e-13 45.0 %
:HMM:PFM   2->100 PF07009 * DUF1312 5.4e-26 40.8 98/113  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36620.1 GT:GENE AAD36620.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1547959..1548279 GB:FROM 1547959 GB:TO 1548279 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36620.1 GB:DB_XREF GI:4982121 LENGTH 106 SQ:AASEQ MLIILIFVVLIFSILASEKKGSKVVVQGRDFRKILSKPGTYDITENGRFLMKVEFDGNRVRVVESTCPLKLCVKTGWVGPGGTIICVPNEVIIFFEEKTDYDTVTW GT:EXON 1|1-106:0| SEG 2->15|liilifvvlifsil| RP:PFM:NREP 1 RP:PFM:REP 17->96|PF07009|6e-13|45.0|80/113|DUF1312| HM:PFM:NREP 1 HM:PFM:REP 2->100|PF07009|5.4e-26|40.8|98/113|DUF1312| RP:SCP:NREP 1 RP:SCP:REP 19->93|1m1gA1|1e-15|26.4|72/81|b.114.1.1| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 106-107| PSIPRED cEEEHHHHHHHHHHccccccccEEEEEEEccEEEEEEcccEEEcccccEEEEEEEEccEEEEEEccccHHHHHHccccccccEEEEEccEEEEEEEEEccEEEEEc //