[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36621.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->180 PF07456 * Hpre_diP_synt_I 1e-13 37.1 %
:HMM:PFM   40->181 PF07456 * Hpre_diP_synt_I 1.2e-40 38.7 142/148  
:BLT:SWISS 69->202 AT221_EMENI 4e-04 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36621.1 GT:GENE AAD36621.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1548186..1548821 GB:FROM 1548186 GB:TO 1548821 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36621.1 GB:DB_XREF GI:4982122 LENGTH 211 SQ:AASEQ MGWSRRDHHLCAKRGDNILRRKDRLRYRDLVRRITFLSVLTALSSTFYVLENLLPFPVPFGRWGFSNSVVLMIASEIGFGDALIVASAKSILGALFSGRFLSPSFLTGFFGAVSASLVESFLARFDFGYLSLSAMGSFVNNLVQLIVISFLVGSTKTFLLFPLMVILGLVSGTVNAFLASRMGGIVFENYSRFFFAQKKATDGVAGDRVRS GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 69->202|AT221_EMENI|4e-04|30.0|130/580| TM:NTM 5 TM:REGION 35->57| TM:REGION 70->92| TM:REGION 102->124| TM:REGION 130->152| TM:REGION 161->183| SEG 19->33|lrrkdrlryrdlvrr| RP:PFM:NREP 1 RP:PFM:REP 40->180|PF07456|1e-13|37.1|140/147|Hpre_diP_synt_I| HM:PFM:NREP 1 HM:PFM:REP 40->181|PF07456|1.2e-40|38.7|142/148|Hpre_diP_synt_I| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------11-------11----------1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 208-211| PSIPRED ccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //