[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36633.1
DDBJ      :             ribosomal protein S16
Swiss-Prot:RS16_THESQ   RecName: Full=30S ribosomal protein S16;

Homologs  Archaea  0/68 : Bacteria  848/915 : Eukaryota  94/199 : Viruses  0/175   --->[See Alignment]
d.27.1
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->80 2j00P PDBj 1e-22 55.0 %
:RPS:PDB   1->80 3bbnP PDBj 1e-26 39.2 %
:RPS:SCOP  1->78 1vs5P1  d.27.1.1 * 7e-28 39.7 %
:HMM:SCOP  1->81 1fjgP_ d.27.1.1 * 6.2e-28 50.6 %
:RPS:PFM   8->65 PF00886 * Ribosomal_S16 2e-10 51.7 %
:HMM:PFM   8->65 PF00886 * Ribosomal_S16 4.9e-28 51.7 58/62  
:BLT:SWISS 1->95 RS16_THESQ 6e-52 100.0 %
:PROS 2->11|PS00732|RIBOSOMAL_S16

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36633.1 GT:GENE AAD36633.1 GT:PRODUCT ribosomal protein S16 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1556271..1556558 GB:FROM 1556271 GB:TO 1556558 GB:DIRECTION + GB:PRODUCT ribosomal protein S16 GB:NOTE similar to SP:P21474 PID:2309081 GB:AL009126 percent identity: 73.03; identified by sequence similarity; putative GB:PROTEIN_ID AAD36633.1 GB:DB_XREF GI:4982135 LENGTH 95 SQ:AASEQ MVRIRLTRMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKEGEIKIDVERAVEWILKGAQPSDTVRDIFRKFGVMKRVHEIKYGKKEEATAE GT:EXON 1|1-95:0| SW:ID RS16_THESQ SW:DE RecName: Full=30S ribosomal protein S16; SW:GN Name=rpsP; OrderedLocusNames=TRQ2_1229; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|RS16_THESQ|6e-52|100.0|95/95| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 2->11|PS00732|RIBOSOMAL_S16|PDOC00600| BL:PDB:NREP 1 BL:PDB:REP 1->80|2j00P|1e-22|55.0|80/83| RP:PDB:NREP 1 RP:PDB:REP 1->80|3bbnP|1e-26|39.2|79/80| RP:PFM:NREP 1 RP:PFM:REP 8->65|PF00886|2e-10|51.7|58/62|Ribosomal_S16| HM:PFM:NREP 1 HM:PFM:REP 8->65|PF00886|4.9e-28|51.7|58/62|Ribosomal_S16| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00886|IPR000307| GO:PFM GO:0005622|"GO:intracellular"|PF00886|IPR000307| GO:PFM GO:0005840|"GO:ribosome"|PF00886|IPR000307| GO:PFM GO:0006412|"GO:translation"|PF00886|IPR000307| RP:SCP:NREP 1 RP:SCP:REP 1->78|1vs5P1|7e-28|39.7|78/82|d.27.1.1| HM:SCP:REP 1->81|1fjgP_|6.2e-28|50.6|81/83|d.27.1.1|1/1|Ribosomal protein S16| OP:NHOMO 984 OP:NHOMOORG 942 OP:PATTERN -------------------------------------------------------------------- 111111-1111111111----11111-----11111-11111111111-111111-1111111111111111111---111-1111111111111111111111111111--------------1111111111-1111111111111111111111111111-11111111111111111111111111-111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111--1-----1111-1111-1--1--11111111111111111111111111111111111111-11111111111111111111111--11111111111111111111111111111111-111111111111111121111111111111111111111111111111111111111111111111111111111--111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1-11-1-1-1111111111111111111111111111 ------------111111111111111111111--111111111-1-11111111--11111111-11-111111-1-11111111-1----1----------112--------------------------------------------------------------------33112M1122242221231111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 100.0 SQ:SECSTR cEEEcccccccTTccccccccEETTcccccccccccccccTTccEcccccTTTccccTTcccEEcTTTccccTTTTccccHccTTEEEEEETTEE DISOP:02AL 80-95| PSIPRED cEEEEEEccccccccEEEEEEEcccccccccHHEEcccccccccccEEEcHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHcccccccccc //