[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36635.1
DDBJ      :             16S rRNA processing protein, putative
Swiss-Prot:RIMM_THEP1   RecName: Full=Ribosome maturation factor rimM;

Homologs  Archaea  0/68 : Bacteria  621/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.41.1b.43.3
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->165 2dyiA PDBj 5e-14 30.3 %
:RPS:PDB   11->169 2dyiA PDBj 2e-25 24.7 %
:RPS:SCOP  11->100 2f1lA2  b.43.3.4 * 2e-15 28.4 %
:RPS:SCOP  107->174 2f1lA1  b.41.1.4 * 3e-13 29.4 %
:HMM:SCOP  11->101 2f1lA2 b.43.3.4 * 5.2e-21 39.3 %
:HMM:SCOP  107->176 2f1lA1 b.41.1.4 * 1.1e-16 42.9 %
:RPS:PFM   15->98 PF01782 * RimM 5e-09 37.3 %
:RPS:PFM   105->169 PF05239 * PRC 1e-05 40.3 %
:HMM:PFM   15->96 PF01782 * RimM 1.7e-23 39.5 81/84  
:HMM:PFM   104->174 PF05239 * PRC 3.1e-16 35.8 67/79  
:BLT:SWISS 1->176 RIMM_THEP1 2e-98 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36635.1 GT:GENE AAD36635.1 GT:PRODUCT 16S rRNA processing protein, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1556787..1557317 GB:FROM 1556787 GB:TO 1557317 GB:DIRECTION + GB:PRODUCT 16S rRNA processing protein, putative GB:NOTE similar to SP:P21504 percent identity: 60.58; identified by sequence similarity; putative GB:PROTEIN_ID AAD36635.1 GB:DB_XREF GI:4982137 LENGTH 176 SQ:AASEQ MIRTIQDLLNERVAIGKIVNTHGLKGEVKFFPYTNSEEIVKNLSSVVLYNSEKKAFYNLTVESVRRMNKLFLIRFKSIDTIEAAERIKGCEVFIKYEELPKLSEDEYYFYEILDCDVFYESGENVGKVVDIIETGSNDVLVVRKKKKETLIPMTKDCIVEIDKGAKKIIAKEMEWI GT:EXON 1|1-176:0| SW:ID RIMM_THEP1 SW:DE RecName: Full=Ribosome maturation factor rimM; SW:GN Name=rimM; OrderedLocusNames=Tpet_1224; SW:KW Chaperone; Complete proteome; Cytoplasm; Ribosome biogenesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->176|RIMM_THEP1|2e-98|100.0|176/176| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0042254|"GO:ribosome biogenesis"|Ribosome biogenesis| BL:PDB:NREP 1 BL:PDB:REP 13->165|2dyiA|5e-14|30.3|142/162| RP:PDB:NREP 1 RP:PDB:REP 11->169|2dyiA|2e-25|24.7|146/162| RP:PFM:NREP 2 RP:PFM:REP 15->98|PF01782|5e-09|37.3|83/84|RimM| RP:PFM:REP 105->169|PF05239|1e-05|40.3|62/77|PRC| HM:PFM:NREP 2 HM:PFM:REP 15->96|PF01782|1.7e-23|39.5|81/84|RimM| HM:PFM:REP 104->174|PF05239|3.1e-16|35.8|67/79|PRC| GO:PFM:NREP 1 GO:PFM GO:0006364|"GO:rRNA processing"|PF01782|IPR002676| RP:SCP:NREP 2 RP:SCP:REP 11->100|2f1lA2|2e-15|28.4|88/89|b.43.3.4| RP:SCP:REP 107->174|2f1lA1|3e-13|29.4|68/75|b.41.1.4| HM:SCP:REP 11->101|2f1lA2|5.2e-21|39.3|89/0|b.43.3.4|1/1|Translation proteins| HM:SCP:REP 107->176|2f1lA1|1.1e-16|42.9|70/0|b.41.1.4|1/1|PRC-barrel domain| OP:NHOMO 625 OP:NHOMOORG 624 OP:PATTERN -------------------------------------------------------------------- 1----11-111---1------1--11-----11-----1--------------1----------11----------------111111----1--------1111-11------------------11-11--1111111111111--11-11--11111-1-1-1111111---------1-1-11111-11111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111-1111111111111111111-11------11111111111111111111111111111----------1111---1---------1-----11111111--------------1-------------11111111111111-11-11111-----------1----1111--------1111111----1111-1111-11-1111111111111111111-111--11--1--1111111111111-11112-----11111------------11-111111111111111111111111111111111-111-111-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----1-11-----------1--1-1-------------------------1111111111--- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----11------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 92.6 SQ:SECSTR ##########cEEEEEEEEEEccccccEEEEEcGGGGGccEEEcEEEEEEETETTTEEEEEEEEEEETTEEEEEETTcccHHHHHTTTTcEEEEEGGGcccccTTcccHHHHTTcEEcEETTEEEEEEEEEEEETTEEEEEEGGGcTTEEEETTcTTcTTEEEccccEE##EEcc# DISOP:02AL 1-6| PSIPRED ccccccccccccEEEEEEEcccEEEEEEEEEEccccHHHHccccEEEEEEccccEEEEEEEEEEEEcccEEEEEEcccccHHHHHHHcccEEEEEHHHccccccccEEEEEEEccEEEEccccEEEEEEEEEEccccEEEEEEccccEEEEEEHHHHccEEEccccEEEEEEcccc //