[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36638.1
DDBJ      :             ribosomal protein L19
Swiss-Prot:RL19_THESQ   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->114 1vorQ PDBj 5e-31 66.7 %
:RPS:PDB   18->111 3bboR PDBj 1e-27 44.6 %
:RPS:SCOP  18->115 2j01T1  b.34.5.6 * 2e-33 62.9 %
:HMM:SCOP  2->115 2gyaN1 b.34.5.6 * 2.6e-37 66.4 %
:RPS:PFM   18->113 PF01245 * Ribosomal_L19 8e-30 75.8 %
:HMM:PFM   3->113 PF01245 * Ribosomal_L19 1.2e-48 63.6 110/113  
:BLT:SWISS 1->115 RL19_THESQ 1e-54 100.0 %
:PROS 87->102|PS01015|RIBOSOMAL_L19
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36638.1 GT:GENE AAD36638.1 GT:PRODUCT ribosomal protein L19 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1558629..1558976 GB:FROM 1558629 GB:TO 1558976 GB:DIRECTION + GB:PRODUCT ribosomal protein L19 GB:NOTE similar to SP:P30529 percent identity: 86.84; identified by sequence similarity; putative GB:PROTEIN_ID AAD36638.1 GB:DB_XREF GI:4982140 LENGTH 115 SQ:AASEQ MDHLVKIIEKKYEKKEIPDFRPGDTVRVHVKVIEGDRERTQVFEGIVIAKRGSGINKTFTVRRIGSHGVGVERIFPVHSPVVEKIEVVRKGKVRRAKLYYLRNVRGKIRIKERRD GT:EXON 1|1-115:0| SW:ID RL19_THESQ SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=TRQ2_1234; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->115|RL19_THESQ|1e-54|100.0|115/115| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 87->102|PS01015|RIBOSOMAL_L19|PDOC00778| SEG 6->17|kiiekkyekkei| BL:PDB:NREP 1 BL:PDB:REP 18->114|1vorQ|5e-31|66.7|96/125| RP:PDB:NREP 1 RP:PDB:REP 18->111|3bboR|1e-27|44.6|92/113| RP:PFM:NREP 1 RP:PFM:REP 18->113|PF01245|8e-30|75.8|95/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 3->113|PF01245|1.2e-48|63.6|110/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 18->115|2j01T1|2e-33|62.9|97/137|b.34.5.6| HM:SCP:REP 2->115|2gyaN1|2.6e-37|66.4|113/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 958 OP:NHOMOORG 927 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 --------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------1112E122113253-32-----11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 85.2 SQ:SECSTR #################ccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTcccccccc DISOP:02AL 111-115| PSIPRED cHHHHHHHHHHHHHccccccccccEEEEEEEEEccccEEEEEEEEEEEEEcccccccEEEEEEEEEcccEEEEEEcccccEEEEEEEEEEccEEHHHEEEEccccccEEEEEEcc //