[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36647.1
DDBJ      :             transcriptional regulator, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  272/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1c.55.1
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   172->307 1ojlD PDBj 1e-12 35.4 %
:RPS:PDB   198->311 2auwA PDBj 5e-13 5.3 %
:RPS:SCOP  172->224 1u6zA3  c.55.1.8 * 4e-07 13.2 %
:RPS:SCOP  221->310 1ntcA  a.4.1.12 * 2e-11 17.7 %
:HMM:SCOP  219->311 1ntcA_ a.4.1.12 * 3.4e-13 27.5 %
:RPS:PFM   268->308 PF02954 * HTH_8 2e-05 41.5 %
:HMM:PFM   268->308 PF02954 * HTH_8 1.6e-15 41.5 41/42  
:BLT:SWISS 172->307 ZRAR_SALTI 3e-13 35.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36647.1 GT:GENE AAD36647.1 GT:PRODUCT transcriptional regulator, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1569546..1570481) GB:FROM 1569546 GB:TO 1570481 GB:DIRECTION - GB:PRODUCT transcriptional regulator, putative GB:NOTE similar to GB:AE000657 percent identity: 59.42; identified by sequence similarity; putative GB:PROTEIN_ID AAD36647.1 GB:DB_XREF GI:4982149 LENGTH 311 SQ:AASEQ MISEISHDVIWDLYEGEDYRDKILAEKWDVVFGEKILEMEDTLFVQSLRELELALKYAAARKDLETIKARFNLLLYTPELQGAKIKEILFQVLKFYNSFSIFALVSEKGVHRHAYVDFVTGGNYLSLIYHEDLPLNINSHTVFIDDVPPDFSPAGLGGRKIILGMDSTPKNNIPFVEIPPLRERKMDIPYMLDGVIKSLQFQGKTVKIDDDLTKLLIEYHWPGNTQEFLEKVYEIITLENPVDQAMKIASGIDEIKGLNLKEFVDSLVEFVEKKVIKKALEENEGNRKKVCEVLNMNYKTLSYKMKKYGLT GT:EXON 1|1-311:0| BL:SWS:NREP 1 BL:SWS:REP 172->307|ZRAR_SALTI|3e-13|35.1|134/441| BL:PDB:NREP 1 BL:PDB:REP 172->307|1ojlD|1e-12|35.4|127/297| RP:PDB:NREP 1 RP:PDB:REP 198->311|2auwA|5e-13|5.3|114/148| RP:PFM:NREP 1 RP:PFM:REP 268->308|PF02954|2e-05|41.5|41/42|HTH_8| HM:PFM:NREP 1 HM:PFM:REP 268->308|PF02954|1.6e-15|41.5|41/42|HTH_8| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF02954|IPR002197| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02954|IPR002197| RP:SCP:NREP 2 RP:SCP:REP 172->224|1u6zA3|4e-07|13.2|53/177|c.55.1.8| RP:SCP:REP 221->310|1ntcA|2e-11|17.7|79/91|a.4.1.12| HM:SCP:REP 219->311|1ntcA_|3.4e-13|27.5|91/0|a.4.1.12|1/1|Homeodomain-like| OP:NHOMO 501 OP:NHOMOORG 272 OP:PATTERN -------------------------------------------------------------------- 244--------------------------------------------------------------------------------333232222---------2--1--1----------------111--121112---------------------------------------------------------12-------121---2113221111211--2--11111-3--------------------------------------------------------------------------------------------56115556445132-1113111-2------1-1147531422313--1--61-----------2-----11--1------------11-11-1--1---------------1-1-------------------------------------------------------------------------------------------1-1-------1--------------1-------------11129344542-22221-38333673322423385--1---------------------------1111--2121111-1111112111222------2-------------2112222312-1221322121122222221222--1--1111111-11111111--111112-----------------------11111-4--111--11--------11-111----1-----1111-1111-111--------------11111-------------------------1122-111-111-1--------------------------12122121112-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 60.5 SQ:SECSTR ###########################################################################################################################EEccTEEEcTTccEEEEEcTTccEEEEccccEEEEEEEHHHHHHHTGGHHHHHHHHHHHHcHHHHcHcHHHHHHccccEEEEEEccTTEEEEEETTccEEEEEcHHHHHHcGGGGGGGcHHHHTTcEEcTTTcccHHHHHHHHHHHTTcccHHHHHHHHTTccHHHHHHHHTccHHHHHHHTTccccc DISOP:02AL 1-5, 250-266| PSIPRED cccccccHHHHHHHHcccccHHHHHHHHEEEEEHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccHHHHHcccccccEEEEEccccccccccccEEEEEcccccHHHHHHHccccccHHHHHHHHcEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHccc //