[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36649.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:147 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->147 PF04308 * DUF458 9e-23 41.8 %
:HMM:PFM   13->147 PF04308 * DUF458 6.5e-46 45.2 135/144  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36649.1 GT:GENE AAD36649.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1571756..1572199 GB:FROM 1571756 GB:TO 1572199 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000657 percent identity: 47.24; identified by sequence similarity; putative GB:PROTEIN_ID AAD36649.1 GB:DB_XREF GI:4982152 LENGTH 147 SQ:AASEQ MKSPTWGKVDYRTVRELIKKFTEGYKYSVFVGTDSDVKDGKVIYATALVVYRFGSGATYFYTVYRDGNGKDLYSRIFKEAEMSLEMARFVEEILKLGKPVVHLDIGYEGLTKDLVSSVIGYVKGVGYPYQIKPDSFAATKIAHKHTK GT:EXON 1|1-147:0| RP:PFM:NREP 1 RP:PFM:REP 14->147|PF04308|9e-23|41.8|134/144|DUF458| HM:PFM:NREP 1 HM:PFM:REP 13->147|PF04308|6.5e-46|45.2|135/144|DUF458| OP:NHOMO 50 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------1-1111111111111111--11-1111-------------1--------------------------------------------------------------------------------------------1-1---------------------1--1---11111111111111-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccccccHHHHHHHHHHHHccccEEEEEEEcccccccEEEEEEEEEEEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHEEcccccEEEccccHHHHHHHHcccc //