[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36658.1
DDBJ      :             ribosomal protein L35
Swiss-Prot:RL35_THESQ   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:65 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->31 3bbo5 PDBj 5e-05 51.7 %
:RPS:PDB   3->62 3bbo5 PDBj 7e-06 31.7 %
:RPS:SCOP  2->62 2hgj71  d.301.1.1 * 2e-06 26.2 %
:HMM:SCOP  2->65 2i2t31 d.301.1.1 * 3.1e-17 43.8 %
:HMM:PFM   2->62 PF01632 * Ribosomal_L35p 7.2e-20 50.8 61/61  
:BLT:SWISS 1->65 RL35_THESQ 3e-24 100.0 %
:PROS 5->31|PS00936|RIBOSOMAL_L35
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36658.1 GT:GENE AAD36658.1 GT:PRODUCT ribosomal protein L35 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1581273..1581470 GB:FROM 1581273 GB:TO 1581470 GB:DIRECTION + GB:PRODUCT ribosomal protein L35 GB:NOTE similar to SP:P55874 PID:1770008 GB:AL009126 percent identity: 65.62; identified by sequence similarity; putative GB:PROTEIN_ID AAD36658.1 GB:DB_XREF GI:4982162 LENGTH 65 SQ:AASEQ MPKVKTNRSAAKRFRITKNGKIMRNHAYRSHKTGKKRRNALRALRKKDVVSSADKNRVLRLLGKK GT:EXON 1|1-65:0| SW:ID RL35_THESQ SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=TRQ2_1254; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->65|RL35_THESQ|3e-24|100.0|65/65| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 5->31|PS00936|RIBOSOMAL_L35|PDOC00721| SEG 35->47|kkrrnalralrkk| BL:PDB:NREP 1 BL:PDB:REP 3->31|3bbo5|5e-05|51.7|29/62| RP:PDB:NREP 1 RP:PDB:REP 3->62|3bbo5|7e-06|31.7|60/62| HM:PFM:NREP 1 HM:PFM:REP 2->62|PF01632|7.2e-20|50.8|61/61|Ribosomal_L35p| RP:SCP:NREP 1 RP:SCP:REP 2->62|2hgj71|2e-06|26.2|61/63|d.301.1.1| HM:SCP:REP 2->65|2i2t31|3.1e-17|43.8|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 92.3 SQ:SECSTR ##cccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEEEcccTHHHHTTTTTT### DISOP:02AL 1-10, 29-42| PSIPRED cccccccHHHHHHcccccccccHHHHcHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHccc //