[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36660.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  770/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->222 2ph1A PDBj 1e-39 48.4 %
:RPS:PDB   35->229 2b9bA PDBj 5e-28 9.8 %
:RPS:SCOP  33->229 1g3qA  c.37.1.10 * 1e-23 23.8 %
:HMM:SCOP  4->228 1f48A2 c.37.1.10 * 1.4e-58 32.1 %
:RPS:PFM   111->191 PF10609 * ParA 4e-25 58.0 %
:HMM:PFM   111->191 PF10609 * ParA 3.6e-34 61.7 81/81  
:HMM:PFM   7->128 PF09140 * MipZ 3e-11 33.9 112/261  
:BLT:SWISS 33->228 Y949_PYRHO 9e-52 51.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36660.1 GT:GENE AAD36660.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1581851..1582594 GB:FROM 1581851 GB:TO 1582594 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 72.27; identified by sequence similarity; putative GB:PROTEIN_ID AAD36660.1 GB:DB_XREF GI:4982164 LENGTH 247 SQ:AASEQ MEKTKKIAVMSGKGGVGKTTVAVNLAVALAAEGYQVGLLDLDLHGPNVQRMLGVSLPPSEGEKIVPAKYGDSLKVFSLAMILQEGAPVIWRGPLKHKAIEQLTRDVEWGDLDYLICDLPPGTGDEALSTFQIIKPDAVIVVSTPQKVAGDDVRRAINFVKRLSGKILGLVENMSYLVCPNCGEKIYVFGKGETEKLAEEFGIPLIARIPMDPEVVSLSDEGRPAVVYKRGTVIEEEFKKIVEKVLSL GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 33->228|Y949_PYRHO|9e-52|51.8|191/295| SEG 12->31|gkggvgkttvavnlavalaa| SEG 232->244|vieeefkkivekv| BL:PDB:NREP 1 BL:PDB:REP 32->222|2ph1A|1e-39|48.4|184/240| RP:PDB:NREP 1 RP:PDB:REP 35->229|2b9bA|5e-28|9.8|173/478| RP:PFM:NREP 1 RP:PFM:REP 111->191|PF10609|4e-25|58.0|81/81|ParA| HM:PFM:NREP 2 HM:PFM:REP 111->191|PF10609|3.6e-34|61.7|81/81|ParA| HM:PFM:REP 7->128|PF09140|3e-11|33.9|112/261|MipZ| RP:SCP:NREP 1 RP:SCP:REP 33->229|1g3qA|1e-23|23.8|185/237|c.37.1.10| HM:SCP:REP 4->228|1f48A2|1.4e-58|32.1|224/278|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1566 OP:NHOMOORG 1033 OP:PATTERN 11112121211111112112122221131122111111111112222221121122222221112-11 1112111111111111111-111111111111111111211111111111111211111111211111111111111111111111111111-11111-11111111111--------------111111111111111111111111111111111111111111121211111111111111111122111122222222222222211111122111121111111111111111111111111111111----------------------------------------------------------------------1-11111111111111133111111-11111-12221321--11111111111111111111111111111111111111111111-11111111111111111111111111111311111122111111111111111111111111111111111111111111111111111112222111111111111111111111111112111111111111111111111211111111111111111111112231223321---1-1-2211111142111111111111111111111112111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113-111111--------1-1-------------------------1111111111111 2322443-83333333333333333333333333333333333333333332332232333233322223223332222223333322-35333333333333333244384633323233333331334J3-446133351332123113214234338F325432344211433233U3333331243334342224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 93.5 SQ:SECSTR ccccEEEEEEEEcTTccHHHHHHHHHHHHHTTTcTTHHHHHHHccccccTTTHHHcccHHHHHHHHHHHHccHHHHcEcHHHHTTcccccccGGGccccHHHHHHHHGGGHHHHHHHHccccccHHHHHHcccEcEEEEEEEETTTTEHHHHHHHHHEEEEEEEEEEEEEEEEEEEEEEEccEEETTEEEEEccccEEEEETTEEEEcccTTcEEcccEEEccccccEETc################ DISOP:02AL 1-2| PSIPRED ccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHcccccccccccHHcccHHHccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcc //