[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36697.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->90 PF11104 * Competence_A 0.00017 19.6 56/146  
:HMM:PFM   10->42 PF02565 * RecO_C 0.00044 30.0 30/118  
:BLT:SWISS 4->79 SYNE2_HUMAN 2e-04 28.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36697.1 GT:GENE AAD36697.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1618089..1618391) GB:FROM 1618089 GB:TO 1618391 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36697.1 GB:DB_XREF GI:4982203 LENGTH 100 SQ:AASEQ MSVLDEILSVLEETQEDLFDLVGKHIHQLRKKYSDAEINEALRMILFAMEISQKPIIHRVFEDYPREKRIFVEEDLTREEMELFLKGEMNELDLEEKNWF GT:EXON 1|1-100:0| BL:SWS:NREP 1 BL:SWS:REP 4->79|SYNE2_HUMAN|2e-04|28.0|75/6885| HM:PFM:NREP 2 HM:PFM:REP 35->90|PF11104|0.00017|19.6|56/146|Competence_A| HM:PFM:REP 10->42|PF02565|0.00044|30.0|30/118|RecO_C| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHccHHHHHHHHHcccccccccccccc //