[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36725.1
DDBJ      :             S-adenosylmethionine synthetase
Swiss-Prot:METK_THESQ   RecName: Full=S-adenosylmethionine synthetase;         EC=2.5.1.6;AltName: Full=Methionine adenosyltransferase;AltName: Full=AdoMet synthetase;AltName: Full=MAT;

Homologs  Archaea  2/68 : Bacteria  874/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
d.130.1
:395 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->392 1p7lA PDBj e-138 63.0 %
:RPS:PDB   67->312 1dxjA PDBj 1e-61 14.0 %
:RPS:SCOP  2->102 1fugA1  d.130.1.1 * 7e-47 63.4 %
:RPS:SCOP  120->242 1fugA2  d.130.1.1 * 6e-57 56.1 %
:RPS:SCOP  243->395 1fugA3  d.130.1.1 * 1e-77 65.6 %
:HMM:SCOP  1->102 1mxaA1 d.130.1.1 * 1.2e-45 65.7 %
:HMM:SCOP  119->242 1mxaA2 d.130.1.1 * 1.4e-53 70.2 %
:HMM:SCOP  243->388 1qm4A3 d.130.1.1 * 2e-77 74.5 %
:RPS:PFM   4->100 PF00438 * S-AdoMet_synt_N 2e-37 70.1 %
:RPS:PFM   123->241 PF02772 * S-AdoMet_synt_M 2e-50 73.1 %
:RPS:PFM   243->382 PF02773 * S-AdoMet_synt_C 6e-61 74.6 %
:HMM:PFM   243->382 PF02773 * S-AdoMet_synt_C 5e-72 69.6 138/138  
:HMM:PFM   124->241 PF02772 * S-AdoMet_synt_M 1.6e-57 69.5 118/120  
:HMM:PFM   2->100 PF00438 * S-AdoMet_synt_N 5.6e-47 67.7 99/100  
:BLT:SWISS 1->395 METK_THESQ 0.0 100.0 %
:PROS 126->136|PS00376|ADOMET_SYNTHETASE_1
:PROS 269->277|PS00377|ADOMET_SYNTHETASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36725.1 GT:GENE AAD36725.1 GT:PRODUCT S-adenosylmethionine synthetase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1646449..1647636) GB:FROM 1646449 GB:TO 1647636 GB:DIRECTION - GB:PRODUCT S-adenosylmethionine synthetase GB:NOTE similar to SP:P54419 PID:1389732 PID:2293164 GB:AL009126 percent identity: 81.84; identified by sequence similarity; putative GB:PROTEIN_ID AAD36725.1 GB:DB_XREF GI:4982232 LENGTH 395 SQ:AASEQ MRRLFTSESVTEGHPDKIADQISDAILDAMLEQDPRSRVAVETLVTTGLVIIAGEVTTRAYVEIPDIARKTILEIGYTRAKYGFDGETCGVLTSIHSQSPDIALGVDKALEVKTGEEVADEFEALGAGDQGIMFGYATNETPEYMPLPITLAHKLAMRLAEVRKNGTLPFLRPDGKTQVTIEYEDDKPVRVDTVLISTQHDPDISQADLREAIIEHVINPVIPEQYRDDKMKILVNPTGRFVLGGPMADTGLTGRKIIVDTYGGWVPHGGGAFSGKDPTKVDRSAHYMARYVAKNVVAAGLADKFLIQLSYAIGVAKPVSIMIDTYGTAKVDEDKLLKVITELFDFRPGAIIKKLNLLRPIYRKTAAYGHFGRNEEEFTWEKLDMVDELKRAFNM GT:EXON 1|1-395:0| SW:ID METK_THESQ SW:DE RecName: Full=S-adenosylmethionine synthetase; EC=2.5.1.6;AltName: Full=Methionine adenosyltransferase;AltName: Full=AdoMet synthetase;AltName: Full=MAT; SW:GN Name=metK; OrderedLocusNames=TRQ2_1171; SW:KW ATP-binding; Cobalt; Complete proteome; Cytoplasm; Magnesium;Metal-binding; Nucleotide-binding; One-carbon metabolism; Potassium;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->395|METK_THESQ|0.0|100.0|395/395| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 126->136|PS00376|ADOMET_SYNTHETASE_1|PDOC00369| PROS 269->277|PS00377|ADOMET_SYNTHETASE_2|PDOC00369| BL:PDB:NREP 1 BL:PDB:REP 2->392|1p7lA|e-138|63.0|378/383| RP:PDB:NREP 1 RP:PDB:REP 67->312|1dxjA|1e-61|14.0|222/242| RP:PFM:NREP 3 RP:PFM:REP 4->100|PF00438|2e-37|70.1|97/100|S-AdoMet_synt_N| RP:PFM:REP 123->241|PF02772|2e-50|73.1|119/120|S-AdoMet_synt_M| RP:PFM:REP 243->382|PF02773|6e-61|74.6|138/138|S-AdoMet_synt_C| HM:PFM:NREP 3 HM:PFM:REP 243->382|PF02773|5e-72|69.6|138/138|S-AdoMet_synt_C| HM:PFM:REP 124->241|PF02772|1.6e-57|69.5|118/120|S-AdoMet_synt_M| HM:PFM:REP 2->100|PF00438|5.6e-47|67.7|99/100|S-AdoMet_synt_N| GO:PFM:NREP 9 GO:PFM GO:0004478|"GO:methionine adenosyltransferase activity"|PF00438|IPR002133| GO:PFM GO:0005524|"GO:ATP binding"|PF00438|IPR002133| GO:PFM GO:0006730|"GO:one-carbon metabolic process"|PF00438|IPR002133| GO:PFM GO:0004478|"GO:methionine adenosyltransferase activity"|PF02772|IPR002133| GO:PFM GO:0005524|"GO:ATP binding"|PF02772|IPR002133| GO:PFM GO:0006730|"GO:one-carbon metabolic process"|PF02772|IPR002133| GO:PFM GO:0004478|"GO:methionine adenosyltransferase activity"|PF02773|IPR002133| GO:PFM GO:0005524|"GO:ATP binding"|PF02773|IPR002133| GO:PFM GO:0006730|"GO:one-carbon metabolic process"|PF02773|IPR002133| RP:SCP:NREP 3 RP:SCP:REP 2->102|1fugA1|7e-47|63.4|101/102|d.130.1.1| RP:SCP:REP 120->242|1fugA2|6e-57|56.1|123/129|d.130.1.1| RP:SCP:REP 243->395|1fugA3|1e-77|65.6|151/152|d.130.1.1| HM:SCP:REP 1->102|1mxaA1|1.2e-45|65.7|102/102|d.130.1.1|1/1|S-adenosylmethionine synthetase| HM:SCP:REP 119->242|1mxaA2|1.4e-53|70.2|124/124|d.130.1.1|1/1|S-adenosylmethionine synthetase| HM:SCP:REP 243->388|1qm4A3|2e-77|74.5|141/144|d.130.1.1|1/1|S-adenosylmethionine synthetase| OP:NHOMO 1351 OP:NHOMOORG 1068 OP:PATTERN ------------------------------------------------------------------11 1221111111211111111-1111111111111111111112211111111111111111111222211111111111111111111111111111---11111111111---------------111111111112112211211111122111111111111111221111111111111111111--1111111111211111111111111111111111111111111111111111111111111111111111111111111111111111112111111121111111111111112111111111111111111121121111111121213311111111111111112111121121111111111111111111-1111111211111111111111-11111111121111111111111111111111111111111111111111111121121111111---1----2---211111111111111111111111111111111111111111111111111111111111111111111111111111112111131111111111111221111111111111111111111111111111111121122111111111111111111111111111111111-111221--11111111111112111211-111111211112111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112---11-11111111111111111111111111111111 1111111-429111111111111212111111111111111111111-1111111111111111111111221111222211111111-11111111111111112-12337C55581242222322328J2-32412123212122221213322322-3911232A21368411111N211115358154-231116 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 391 STR:RPRED 99.0 SQ:SECSTR #cEEEEEEEEcTccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHcGGGEEccccccHHHHHHHTTTTTcTTccccccccHHHHHHHHTTcTHTTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccTTGGGcTTccccccccccccccTTccccTTccTcccHHHHHHHHHHHHHTccTTTcTTHHHHcHHHHHHHHHHcccTTcccHHHHHTTcccccHHHHHTTccccHHHHHHHHTTTTTTTcccHHHHHccccccHHHHHHHHHHHHHHHHHTcccccccccTTcccccTTcccccEEEEEcTTcccccHHHHHHHHHHHccccHHHHHHHHTccccccGGGGcccccccccTTcTTTcccHHHHHHHT### DISOP:02AL 395-396| PSIPRED ccEEEccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEEEEEccEEEHHHHHHHHHHHcccccHHcccccccEEEEEcccccccHHHHcccccccccccccccccHHHccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHccHHccccccEEEEcccccEEcccccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccc //