[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36726.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   25->104 2br2A PDBj 5e-04 12.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36726.1 GT:GENE AAD36726.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1647710..1648036) GB:FROM 1647710 GB:TO 1648036 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36726.1 GB:DB_XREF GI:4982234 LENGTH 108 SQ:AASEQ MLFLFFGKKKKDLNKNPFYREKGSLVVYIKCDRCGEVFRSHLRTGYDFIVDYDNPGVPYKIDKLYVGSKCPNKIHLVATFTSSYKPVSVSLEGGTFITREEFEESQKQ GT:EXON 1|1-108:0| SEG 2->15|lflffgkkkkdlnk| RP:PDB:NREP 1 RP:PDB:REP 25->104|2br2A|5e-04|12.8|78/260| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 72.2 SQ:SECSTR ########################EEEccEEEEEEEEEEcccccccEEEEEEEETTEEE#EcccHHHHHHccEEEEEE#EcTTccEEEEEEEccccccHHHHHH#### DISOP:02AL 6-7, 102-108| PSIPRED cEEEEEccccccccccccEEccccEEEEEEEccHHHHHHHHHccccEEEEEcccccccEEEEEEEEccccccEEEEEEEEcccccEEEEEEcccEEEEHHHHHHHHcc //