[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36735.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  231/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   54->161 PF02643 * DUF192 3e-25 50.5 %
:HMM:PFM   55->162 PF02643 * DUF192 1.8e-36 49.5 105/108  
:BLT:SWISS 52->131 Y1496_METJA 1e-04 34.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36735.1 GT:GENE AAD36735.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1654794..1655285 GB:FROM 1654794 GB:TO 1655285 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000783 percent identity: 57.94; identified by sequence similarity; putative GB:PROTEIN_ID AAD36735.1 GB:DB_XREF GI:4982243 LENGTH 163 SQ:AASEQ MWGLRPLFLRLQKFLLPLLITIGIIVVVVVSGQSDRVKFPKGRIVITDGEKSLKLDVEIANTPALRSIGLMYRKSIPDDFGMLFVFEEDTCSGFWMKNTYVPLEIAFIDKNGVIFSIQEMEPCKEEPCKIYYAPGPFRYALEVKKGFFERHRFGVGSRVSIEK GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 52->131|Y1496_METJA|1e-04|34.2|76/114| TM:NTM 1 TM:REGION 7->29| SEG 4->30|lrplflrlqkfllpllitigiivvvvv| RP:PFM:NREP 1 RP:PFM:REP 54->161|PF02643|3e-25|50.5|105/108|DUF192| HM:PFM:NREP 1 HM:PFM:REP 55->162|PF02643|1.8e-36|49.5|105/108|DUF192| OP:NHOMO 242 OP:NHOMOORG 237 OP:PATTERN ------------------------1---11------------------------------------11 -------------------------------------------1--------------------------------------1-----------------2--111-12---------------------1---11---11-----111111111111-11-111112211---------------11111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111--111111111111111111--11111111111-111111111111111-11-111111111111111111111111------------------------------1-11-1111111111111-111111111111111111111111111111111111111------------1111111-----------------------111111--------------------------------11--11-----------------------1---1---------------------------------------------------------------------------------------------------------1-----------------------------------------1---------------------------11111111111111----1111111111111111----------------------------1--1-11111- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 161-163| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccEEEEEEEEEccHHHHHHHccccccccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEccccccccccccccccccEEEEEEccccHHHHHccccccEEEEEc //