[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36767.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->188 1x42A PDBj 2e-06 27.3 %
:RPS:PDB   3->198 3d6jA PDBj 4e-14 19.3 %
:RPS:SCOP  3->188 1x42A1  c.108.1.1 * 2e-18 28.1 %
:RPS:SCOP  164->198 1j8dA  c.108.1.5 * 4e-05 26.5 %
:HMM:SCOP  1->203 1vj5A1 c.108.1.2 * 1e-23 27.7 %
:RPS:PFM   129->193 PF00702 * Hydrolase 3e-04 40.0 %
:HMM:PFM   3->184 PF00702 * Hydrolase 1.8e-14 23.0 165/192  
:BLT:SWISS 135->201 YHCW_BACSU 5e-06 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36767.1 GT:GENE AAD36767.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1679096..1679704) GB:FROM 1679096 GB:TO 1679704 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36767.1 GB:DB_XREF GI:4982277 LENGTH 202 SQ:AASEQ MSVRIFLFDYDGTLAEDNGFAEEYFKKLTSFFRDRGVSISPELVLGCVEEITRNPDGSTNLERYMKCLEKRTSQCAEKWKELFMEFYESELFDSLKGTVEPVKGTVDLLKEKKKEGKVVLATNPVFPRIAILKRLNWIGLSEDDFHLITDMESFHFCKPDPRYYLEICEKMGVSPEDCVMYGDDELNDGECEKVGMKFIRVR GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 135->201|YHCW_BACSU|5e-06|34.8|66/220| SEG 108->120|llkekkkegkvvl| BL:PDB:NREP 1 BL:PDB:REP 3->188|1x42A|2e-06|27.3|176/223| RP:PDB:NREP 1 RP:PDB:REP 3->198|3d6jA|4e-14|19.3|176/206| RP:PFM:NREP 1 RP:PFM:REP 129->193|PF00702|3e-04|40.0|60/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 3->184|PF00702|1.8e-14|23.0|165/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 2 RP:SCP:REP 3->188|1x42A1|2e-18|28.1|171/230|c.108.1.1| RP:SCP:REP 164->198|1j8dA|4e-05|26.5|34/180|c.108.1.5| HM:SCP:REP 1->203|1vj5A1|1e-23|27.7|195/226|c.108.1.2|1/1|HAD-like| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------11-----------------------------------------1--------------------------------------------------------------------------------------------11--------------------1----1---111-1-1111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 100.0 SQ:SECSTR ccccEEEEcccTTTEEcHHHHHHHHHHHHHHHHHTTcccccHHHHTTTTcHHHHHHHHTTcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEccccHHHHHHHHHTccTTcGHTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEEEcT DISOP:02AL 202-203| PSIPRED ccccEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccccccccEEEEHHHcccccccHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEc //