[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36768.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  467/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
:458 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->185 PF01554 * MatE 1e-16 36.5 %
:RPS:PFM   246->399 PF01554 * MatE 3e-04 27.9 %
:HMM:PFM   27->186 PF01554 * MatE 1.1e-37 35.6 160/162  
:HMM:PFM   246->411 PF01554 * MatE 6.1e-29 24.7 162/162  
:BLT:SWISS 10->449 Y709_METJA 2e-72 31.6 %
:PROS 18->33|PS00050|RIBOSOMAL_L23
:TM
:REPEAT 2|1->192|218->416
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36768.1 GT:GENE AAD36768.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1679763..1681139 GB:FROM 1679763 GB:TO 1681139 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000782 percent identity: 71.72; identified by sequence similarity; putative GB:PROTEIN_ID AAD36768.1 GB:DB_XREF GI:4982278 LENGTH 458 SQ:AASEQ MVLERETIGIKLLRGDPRKAIVKLSIPMMLAMLVQTIYNLADGIWVAGLGPYALAAIGLFFPVFMVIISLAAGIGVGASSVVSQKIGERDKEGADTAASVSILLSIVIGFLSIAVILPFISDILIFAGAQGETLRLALEYSVILVYFIPLIMFNNVANGVFRGEGDAKRAMVAITIGSLLNIGLDPVFIYVFGMGIRGAAYATVVSIAVSSLLIAYWMFFKKDTYVSFRLKWDGEILKRILKIGIPASLAQISMSVAIYVLNVFAVRSGGDYGVAVFTSAWRVINFGTVPLIGMAMAVTSVTGAAFGERNGEKLETAHLYAVKLGFFVGLAVMFTILIFAPYIARLFTYSQEGEKLYSDLVKALRILSLFLPGVPFGMFTSSMFQGVGQGLKSLIVTIMRTVIMQVVFSWLFVFVLRIGLVGVWWGIVLGNTTSAFITFNWGRFTVKHLKRDFQKNIT GT:EXON 1|1-458:0| BL:SWS:NREP 1 BL:SWS:REP 10->449|Y709_METJA|2e-72|31.6|440/450| PROS 18->33|PS00050|RIBOSOMAL_L23|PDOC00049| TM:NTM 11 TM:REGION 23->45| TM:REGION 58->80| TM:REGION 101->123| TM:REGION 136->158| TM:REGION 171->193| TM:REGION 199->220| TM:REGION 244->266| TM:REGION 278->300| TM:REGION 322->344| TM:REGION 359->381| TM:REGION 400->422| NREPEAT 1 REPEAT 2|1->192|218->416| SEG 418->430|iglvgvwwgivlg| RP:PFM:NREP 2 RP:PFM:REP 27->185|PF01554|1e-16|36.5|159/161|MatE| RP:PFM:REP 246->399|PF01554|3e-04|27.9|150/161|MatE| HM:PFM:NREP 2 HM:PFM:REP 27->186|PF01554|1.1e-37|35.6|160/162|MatE| HM:PFM:REP 246->411|PF01554|6.1e-29|24.7|162/162|MatE| GO:PFM:NREP 10 GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| OP:NHOMO 1361 OP:NHOMOORG 539 OP:PATTERN 212-2------------------12223132-53111-3343412122-2756-3433334---1--- --1--1------------------------------------------1---111--------1-1--1--2---4331264-1111177881A42---113-2241112--------------------1---11-1111---2-2-----------------1----11------------------11--13333333433433342533233351--3123555555-6-111111111111111--11113-11-2-1-222211221--1333---21111221111111111111111111121111221112222-C87EAAAAAABFAC2E559AA8I63681KE--5511-447-1122-2752-----1-----21313-1-2-1------------1-1--1--11-1--2--222-313--2-1-112-1-1142211111111-111---1-----------------------------1111-------------------------------1111--111--1--2-------------1--------------12-11-1--311112111211-2----262--2311-----122222222213--1--331232222233545524534343334346----1--------3211111---2-21----------------------1111-111222222222221222221--1------111111111111---2------------15---1----1--1---1111112112-2----12221-----221---------1355933333769441111111111-------G22--11222121129-2-------------------------3343223222-13 ----1-----13----1---------------------------------1--1----------11----1-11----------1-------1-----------1-------12913-----------------------1------------1--1----------------2----24--1--3238-5-12----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 456-458| PSIPRED ccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //