[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36769.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36769.1 GT:GENE AAD36769.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1681151..1681534 GB:FROM 1681151 GB:TO 1681534 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36769.1 GB:DB_XREF GI:4982279 LENGTH 127 SQ:AASEQ MLKLEANYSTIEKIVLKSTEGFSQFSLSKEDENLKVKLKHGSFPFSLSVKVKVVSTQKTPDDPIILKVGVPSFLMEMLKSRIEREGLEVHGNEIHIYPKKIARFFEDLIVSRLEFEDDRVILHLEEV GT:EXON 1|1-127:0| SEG 48->55|svkvkvvs| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cEEEEccHHHHHHHHHcccccccEEEcccccccEEEEEEcccccEEEEEEEEEEEccccccccEEEEEccHHHHHHHHHHHHHHcccEEEccEEEEEHHHHHHHHHHHHHHHccccccEEEEEEEcc //