[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36778.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->63 PF05103 * DivIVA 6e-08 25.9 58/131  
:BLT:SWISS 6->87 K1C17_BOVIN 5e-05 29.3 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36778.1 GT:GENE AAD36778.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1690413..1690679) GB:FROM 1690413 GB:TO 1690679 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36778.1 GB:DB_XREF GI:4982288 LENGTH 88 SQ:AASEQ MKELEDLERILDSMIEDYKKLKEENKELWSKVKQLNERILHLEKEKEQLEKTIEQHKRSLNTLVEKIQRFLSLTTDQGMIQDEEENKR GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 6->87|K1C17_BOVIN|5e-05|29.3|82/441| COIL:NAA 69 COIL:NSEG 1 COIL:REGION 1->69| SEG 40->51|lhlekekeqlek| HM:PFM:NREP 1 HM:PFM:REP 6->63|PF05103|6e-08|25.9|58/131|DivIVA| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 46-54, 78-88| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //