[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36809.1
DDBJ      :             L-allo-threonine aldolase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  349/915 : Eukaryota  146/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:343 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->343 1jg8D PDBj 0.0 100.0 %
:RPS:PDB   1->339 2eh6A PDBj 4e-30 14.5 %
:RPS:SCOP  1->343 1jg8A  c.67.1.1 * e-137 96.2 %
:HMM:SCOP  1->343 1jg8A_ c.67.1.1 * 1.7e-135 52.5 %
:RPS:PFM   3->284 PF01212 * Beta_elim_lyase 2e-78 53.8 %
:HMM:PFM   3->285 PF01212 * Beta_elim_lyase 1.1e-103 42.9 280/290  
:BLT:SWISS 2->335 LTAA_AERJA 3e-78 49.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36809.1 GT:GENE AAD36809.1 GT:PRODUCT L-allo-threonine aldolase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1719933..1720964 GB:FROM 1719933 GB:TO 1720964 GB:DIRECTION + GB:PRODUCT L-allo-threonine aldolase GB:NOTE similar to GB:U00096 SP:P75823 PID:1787095 PID:2225892 percent identity: 67.58; identified by sequence similarity; putative GB:PROTEIN_ID AAD36809.1 GB:DB_XREF GI:4982322 LENGTH 343 SQ:AASEQ MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS GT:EXON 1|1-343:0| BL:SWS:NREP 1 BL:SWS:REP 2->335|LTAA_AERJA|3e-78|49.4|326/338| SEG 233->244|agvlaaagiial| BL:PDB:NREP 1 BL:PDB:REP 1->343|1jg8D|0.0|100.0|342/343| RP:PDB:NREP 1 RP:PDB:REP 1->339|2eh6A|4e-30|14.5|331/375| RP:PFM:NREP 1 RP:PFM:REP 3->284|PF01212|2e-78|53.8|279/285|Beta_elim_lyase| HM:PFM:NREP 1 HM:PFM:REP 3->285|PF01212|1.1e-103|42.9|280/290|Beta_elim_lyase| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01212|IPR001597| GO:PFM GO:0016829|"GO:lyase activity"|PF01212|IPR001597| RP:SCP:NREP 1 RP:SCP:REP 1->343|1jg8A|e-137|96.2|343/343|c.67.1.1| HM:SCP:REP 1->343|1jg8A_|1.7e-135|52.5|343/0|c.67.1.1|1/1|PLP-dependent transferases| OP:NHOMO 646 OP:NHOMOORG 499 OP:PATTERN -------------------------111--1------------------------------------- 11212----------------1---1------1111-1---11111-1-11-211-1---111-211221------------1-----1111-1-------11111-111--------------------------1111-11-11--------1-----------1111-------------2111111--1-----------------1--------2---111111113--------------------------------------------------------------------------------------------11-------------111-----1---1-------1--111-111-1--1-11---------1211---21111--1---1-1-1-11-11-111-1-1---11111-111----11-1-11-1---------111---21-------------------------2-4-1111-1111121111111111111212223111121111--11-1-1--112121--1----11-------------1-1-1-----1----2-21221--112111-1---------------------------11-----2-111111111111111121112-------------11--11-1111111111-1111111111111111111111-1---1111111111111111111111111-111111111111---1-----------1-1---------------------------22221222111111111----------11111111112222-----------------1--------------------------------------------11-11111-1- ------1-----1111111212113122233332623333323211121122241111111112222222112121111112222311-12111111111111325-12-1111321-----1-1-----21--------1--1------1------11--1-11111115151--111A111-111221412122421 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 343 STR:RPRED 100.0 SQ:SECSTR EEEccHHHHTcTTHHHHHHHHHcccccTTcccHHHHHHHHHHHHTccccEEEEEEccHHHHHHHHHHHTTccccEEEEEcTccccccHHHHHHcccGGGTTTTccccccEEEEcTTcHHHHHTTccTTEEEEEEccEETTTTcEEccHHHHHHHHHHHHHHTcEEEEEcTTTTTTTTTTccccGGGGGTccccEEEEcGGGGTTcccEEEEEEHHHHTTccTTcccccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccEEEEETTEEEEEHcccccHHHHHHHHHTTEEcEEETTTEEEEcccTTccHHHHHHHHHHHHHHcHHGG PSIPRED cccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccEEEEEEccccccccHHHHHHHcccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEccccccEEccccccHHHHcccccEEEEEccccccHHHHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccEEEEEEccccccHHHHHHHHHHccEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHHHHc //