[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36831.1
DDBJ      :             methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
Swiss-Prot:FOLD_THEMA   RecName: Full=Bifunctional protein folD;Includes:  RecName: Full=Methylenetetrahydrofolate dehydrogenase;           EC=1.5.1.5;Includes:  RecName: Full=Methenyltetrahydrofolate cyclohydrolase;           EC=3.5.4.9;

Homologs  Archaea  27/68 : Bacteria  885/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->269 2c2xA PDBj 1e-34 39.8 %
:RPS:PDB   3->269 2c2xA PDBj 4e-28 34.2 %
:RPS:SCOP  3->136 1edzA2  c.58.1.2 * 7e-24 23.1 %
:HMM:SCOP  1->111 1a4iA2 c.58.1.2 * 1.8e-24 36.9 %
:HMM:SCOP  112->271 1a4iA1 c.2.1.7 * 4.9e-35 38.6 %
:RPS:PFM   3->110 PF00763 * THF_DHG_CYH 6e-12 38.9 %
:RPS:PFM   114->268 PF02882 * THF_DHG_CYH_C 8e-23 42.5 %
:HMM:PFM   113->269 PF02882 * THF_DHG_CYH_C 2.7e-59 58.7 155/161  
:HMM:PFM   2->110 PF00763 * THF_DHG_CYH 3.3e-30 42.2 109/117  
:BLT:SWISS 1->271 FOLD_THEMA e-131 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36831.1 GT:GENE AAD36831.1 GT:PRODUCT methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1743699..1744514 GB:FROM 1743699 GB:TO 1744514 GB:DIRECTION + GB:PRODUCT methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase GB:NOTE similar to SP:P54382 PID:1303916 GB:AL009126 percent identity: 66.67; identified by sequence similarity; putative GB:PROTEIN_ID AAD36831.1 GB:DB_XREF GI:4982346 LENGTH 271 SQ:AASEQ MWIDCKTIARSIEERTKERVEKLGFTPKLVSVACTDDPSALSYLKSQRKKAEKLGIAFEIMNVSPEEIVSTLKKLGSDESVNGVFVARPFPLGLDEKEILSSVPVEKDVEGVNPANLGLLLYDEEIFPPCTAEAAVRILERETNLSGKRVTVVGRSVTVGKPLALMLLKKGRDATVTVCHSRTVNLEEITKNSDIVVVAVGRAHFLKKNMVKEGAIVIDVGINYVDGKLQGDVDPSVEEIARVTPVPGGVGQVTTALLFEHVVRAAERQRK GT:EXON 1|1-271:0| SW:ID FOLD_THEMA SW:DE RecName: Full=Bifunctional protein folD;Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; EC=1.5.1.5;Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; EC=3.5.4.9; SW:GN Name=folD; OrderedLocusNames=TM_1767; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase; Methionine biosynthesis; Multifunctional enzyme; NADP;One-carbon metabolism; Oxidoreductase; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->271|FOLD_THEMA|e-131|100.0|271/271| GO:SWS:NREP 9 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| SEG 146->161|sgkrvtvvgrsvtvgk| SEG 243->255|vtpvpggvgqvtt| BL:PDB:NREP 1 BL:PDB:REP 3->269|2c2xA|1e-34|39.8|266/280| RP:PDB:NREP 1 RP:PDB:REP 3->269|2c2xA|4e-28|34.2|266/280| RP:PFM:NREP 2 RP:PFM:REP 3->110|PF00763|6e-12|38.9|108/118|THF_DHG_CYH| RP:PFM:REP 114->268|PF02882|8e-23|42.5|153/160|THF_DHG_CYH_C| HM:PFM:NREP 2 HM:PFM:REP 113->269|PF02882|2.7e-59|58.7|155/161|THF_DHG_CYH_C| HM:PFM:REP 2->110|PF00763|3.3e-30|42.2|109/117|THF_DHG_CYH| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00763|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF00763|IPR000672| GO:PFM GO:0003824|"GO:catalytic activity"|PF02882|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF02882|IPR000672| RP:SCP:NREP 1 RP:SCP:REP 3->136|1edzA2|7e-24|23.1|134/146|c.58.1.2| HM:SCP:REP 1->111|1a4iA2|1.8e-24|36.9|111/125|c.58.1.2|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 112->271|1a4iA1|4.9e-35|38.6|158/170|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1448 OP:NHOMOORG 1095 OP:PATTERN ------------------11111-21111111-----------11-1111111--------111--11 1111211111111111111-11111111111111111222122111111111221111112221222211111111111112311111111111111--1111111111111111111111111111111111111111111121111111111111111111111111111111111111112211111121111111111111111111111111111111111111111211111111111111111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111211111111111111111111111111111111111111111111111-1-------1211311122111321111111121111313111111111111-11111111111111111111111111111111112311112211111111111111121111111111111111112111111111111111111111-1111111111111111111111111212122111111121111111111111111111111111111111111112111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111112111111111111332211122211111111121111111111111111111111111111111111111111111111111----1-1-1-1-1---111111---1111111111111 ----331-211-11211-1-12121211111111111111-111111222221222211222333222132132322-2223333223-111111111112-1335-14243544531-42222352519N4-5332222311342321131153543333223232633B21121333W222216343-431133332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 98.5 SQ:SECSTR ##ccHHHHHHHHHHHHHHHHHHHTcccEEEEEEEcccHHHHHHHHHHHHHHHHHTcEEEEEEEcHHHHHHHHHHHHHcTTccEEEEcccccTTccHHHHHHHccGGGcTTcccHHHHHHHHHTccccccHHHHHHHHHHHHHTTcTTcEEEEEcccTTTHHHHHHHHTcTTTccEEEEEcTTcccHHHHHTTccEEEEccccTTcccGGGccTTcEEEEccEEEETTEEEEcccGGGGGTcEEEccccccHHHHHHHHHHHHHHHHHHc## DISOP:02AL 270-271| PSIPRED ccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHcccccccccccHHHHHHHHccccccccccHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEcccccHHHHHccccEEEEEEcccccccccccccccEEEEccEEEEcccEEEcccHHHHHccEEccccccHHHHHHHHHHHHHHHHHHHHcc //