[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36836.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  29/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:538 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   129->330 2q7fA PDBj 8e-08 30.5 %
:RPS:PDB   80->298 2cfuA PDBj 2e-16 9.4 %
:RPS:SCOP  73->330 1w3bA  a.118.8.1 * 6e-18 14.3 %
:HMM:SCOP  80->322 1xnfA_ a.118.8.1 * 1.1e-29 29.2 %
:RPS:PFM   252->293 PF06051 * DUF928 9e-05 42.9 %
:HMM:PFM   176->203 PF07719 * TPR_2 1.3e-05 35.7 28/34  
:HMM:PFM   242->271 PF07719 * TPR_2 7.4e-05 40.0 30/34  
:HMM:PFM   137->169 PF00515 * TPR_1 0.00064 27.3 33/34  
:HMM:PFM   206->237 PF00515 * TPR_1 5e-10 31.2 32/34  
:BLT:SWISS 117->354 YRRB_BACSU 1e-08 29.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36836.1 GT:GENE AAD36836.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1749635..1751251 GB:FROM 1749635 GB:TO 1751251 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:L77117 SP:Q58741 PID:1591987 percent identity: 54.39; identified by sequence similarity; putative GB:PROTEIN_ID AAD36836.1 GB:DB_XREF GI:4982351 LENGTH 538 SQ:AASEQ MRGGNIKAIVYLPLDPEKAKQNNLPVKLPVLAEDLPKVLEEDRIPLDVILRGLEAQYEITKDEYYRSYYVFFLYEKFKQLLREGKLDEAEKILEKAKEVQYDYRYHFYRGLLLKHRGELGEAEIEMRLAISMNDRFAPAYFELAGILKEKNEIEDSLLFYEKAYEVNKEFLLPLLKKGDLLLEEGRLEEAIEEYRRILEKDSNFVEVYERLGVIYNQLQRFKEAEKFFKKALEIERKDHVEYNLSYTLIKLGKLFEALEILKRLYEKNPDDPMVANEYGLLLKTLGLYEEALEVFEDAYRRHKEEEILKYNYGTILLHFEKEKAVSILSEISGELKDRAEFMISLAEKDVVIPSYEEFEWLKDYFFEGTIDVVALSEEIDSEDEDAKRRIERLREGEFPFYDTTLDSSEMLEVILGIMFESPDIFKMEENAVKFVSAFYGSSVMIASTIVLTRTFQYFLAEEEPTMEELLRELVAETQDVNWKFSLRLARFRHADRFDFNRLSDLVIAFLQSIEQGTPVSDDERLKYLLEKLTFQKEG GT:EXON 1|1-538:0| BL:SWS:NREP 1 BL:SWS:REP 117->354|YRRB_BACSU|1e-08|29.0|200/206| SEG 169->193|efllpllkkgdllleegrleeaiee| SEG 221->231|fkeaekffkka| SEG 459->473|laeeeptmeellrel| BL:PDB:NREP 1 BL:PDB:REP 129->330|2q7fA|8e-08|30.5|167/194| RP:PDB:NREP 1 RP:PDB:REP 80->298|2cfuA|2e-16|9.4|213/627| RP:PFM:NREP 1 RP:PFM:REP 252->293|PF06051|9e-05|42.9|42/188|DUF928| HM:PFM:NREP 4 HM:PFM:REP 176->203|PF07719|1.3e-05|35.7|28/34|TPR_2| HM:PFM:REP 242->271|PF07719|7.4e-05|40.0|30/34|TPR_2| HM:PFM:REP 137->169|PF00515|0.00064|27.3|33/34|TPR_1| HM:PFM:REP 206->237|PF00515|5e-10|31.2|32/34|TPR_1| RP:SCP:NREP 1 RP:SCP:REP 73->330|1w3bA|6e-18|14.3|258/388|a.118.8.1| HM:SCP:REP 80->322|1xnfA_|1.1e-29|29.2|243/0|a.118.8.1|1/1|TPR-like| OP:NHOMO 57 OP:NHOMOORG 36 OP:PATTERN -------1--------------------------21-----1---------21--------------- -----------------------------------------------------------------------------------1---1--------------------------------------1--1---1--------------3-211-----------------6-2-8---2-3--------------------------------------------------------------------------------------------------------------------------------------------------1----------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1111111111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 361 STR:RPRED 67.1 SQ:SECSTR #####################################################GGGccccccHHHHHHHHHHHHHccccccGGGTccccHHHHHHHHHHHTTcHHHHHHHHHHHHTTcHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHHccHHHHTTccEEEEEEETTTTEEEEEEEETTEEEEEETcccTTHHHHHHTTcccHHHHHHTTcEEEEEcTTHHHHHHHHccHHTTccccccccccccccHccHHHHTTccEEEEEEETTTTEHHHGEEHHHHHHHTTcccHHHHHHHHHHTTcccccccccHHHHHHTHHHHHHHHHHTTTccTHHHHHHHHHHHHHHcTGc####TTHHHHHHHHHHH######################################################################################################################## DISOP:02AL 1-2, 535-538| PSIPRED ccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccc //