[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36837.1
DDBJ      :             phosphonopyruvate decarboxylase, putative
Swiss-Prot:APGM_THEMA   RecName: Full=Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase;         Short=Phosphoglyceromutase;         Short=BPG-independent PGAM;         Short=aPGAM;         EC=5.4.2.1;

Homologs  Archaea  59/68 : Bacteria  57/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
c.76.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->401 2zktB PDBj 2e-58 42.0 %
:RPS:PDB   13->87 1ei6A PDBj 1e-04 21.7 %
:RPS:SCOP  19->90 1aukA  c.76.1.2 * 1e-04 31.8 %
:RPS:SCOP  248->357 1ejjA2  c.76.1.3 * 2e-09 24.2 %
:HMM:SCOP  14->394 2i09A1 c.76.1.5 * 1e-37 25.2 %
:RPS:PFM   50->218 PF10143 * PhosphMutase 4e-43 52.4 %
:HMM:PFM   18->388 PF01676 * Metalloenzyme 2e-47 31.4 223/262  
:BLT:SWISS 1->401 APGM_THEMA 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36837.1 GT:GENE AAD36837.1 GT:PRODUCT phosphonopyruvate decarboxylase, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1751254..1752459 GB:FROM 1751254 GB:TO 1752459 GB:DIRECTION + GB:PRODUCT phosphonopyruvate decarboxylase, putative GB:NOTE similar to GB:AE000657 percent identity: 70.65; identified by sequence similarity; putative GB:PROTEIN_ID AAD36837.1 GB:DB_XREF GI:4982352 LENGTH 401 SQ:AASEQ MFDKQEFVSKLVTEEKAKIVLLVMDGLGDIPVNGKTPLQAANTPNLDNLAKESDLGQTIPVLPGITPGSGPGHLSLFGYDPIKYQIGRGILEALGIGVEVGEKDVVARANFATWDGKVVLDRRAGRPATEESAKVVQLLSEKIKKIEDVEITFYPGKEHRFVVKFTGEGLGDKVTDADPQKEGHPMVWAEGLDEPSKKTARIVNELIKKIAEVLKDNPKINFALIRGFSKYPDLPKFPQVYKMKAGAIATYPMYRGLAKLVGMEIIETGQTVADEIKTLKEKWNDYDFFYVHVKKTDSYGEDGKFEEKVKVIEEVDAIIPEIVSLNPDVLVITGDHSTPVPLKAHSWHPVPLLIWSKYTRRGLSQAFNEFECARGTLGTIHASDVMTLALAYAGKLEKFGA GT:EXON 1|1-401:0| SW:ID APGM_THEMA SW:DE RecName: Full=Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase; Short=Phosphoglyceromutase; Short=BPG-independent PGAM; Short=aPGAM; EC=5.4.2.1; SW:GN Name=apgM; OrderedLocusNames=TM_1774; SW:KW Complete proteome; Glycolysis; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->401|APGM_THEMA|0.0|100.0|401/401| GO:SWS:NREP 2 GO:SWS GO:0006096|"GO:glycolysis"|Glycolysis| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| SEG 304->315|kfeekvkvieev| BL:PDB:NREP 1 BL:PDB:REP 32->401|2zktB|2e-58|42.0|338/381| RP:PDB:NREP 1 RP:PDB:REP 13->87|1ei6A|1e-04|21.7|69/404| RP:PFM:NREP 1 RP:PFM:REP 50->218|PF10143|4e-43|52.4|166/172|PhosphMutase| HM:PFM:NREP 1 HM:PFM:REP 18->388|PF01676|2e-47|31.4|223/262|Metalloenzyme| RP:SCP:NREP 2 RP:SCP:REP 19->90|1aukA|1e-04|31.8|66/481|c.76.1.2| RP:SCP:REP 248->357|1ejjA2|2e-09|24.2|99/274|c.76.1.3| HM:SCP:REP 14->394|2i09A1|1e-37|25.2|242/0|c.76.1.5|1/1|Alkaline phosphatase-like| OP:NHOMO 165 OP:NHOMOORG 134 OP:PATTERN 111111111111111121111112--------222122333331222111111111111111111-11 ----------------------------------------------------------------------------------11----111111-----------------------------------------------222---------------------------------------1111111----------------------------------------------------------------------------------------------------------------------------------------------------1---1-----1-1----1--1-11------------21----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111-11----111111121------31---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------1111111111--- ----11----1--------------------------------------------------------------------------------------------11----1------------------------------------------------------------------11------11-12-21--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 389 STR:RPRED 97.0 SQ:SECSTR ############EcccccEEEEEcTTccHHHHHHTcHHHTTccHHHHHGGGTcEEEEEEccccccHHHHHHHHHHccTccHHHHcccHHHHHHTTccEEEEEccHHHHHHHTTTcccEEEEcTTGGGccHHHHccccHHHHHTcccccccccHHHHHHHHHHHHHEcccTTHHTTcccEEEEEcccHHHHHccTTcHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEcccccccHHHHHTccEEEEcccHHHHHHHHHTTcEEEccccTTccHHHHHHHHHTTccEEEEEEcHHHHHHHTTcHHHHHHHHHHHHHHHHHHccTTTEEEEEEccccccTTTTccccccEEEEEEcTTccccccccccHHHHTTcTTEEEEGGGHHHHHHHHTTccccccc DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHcccccEEEEEEEEcccccccccccHHHHcccccHHHHHHcccccccccccccccccccHHHHHHcccccccccccccHHHHHccccccccccEEEEEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccHHHHHcccEEEEEccHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccEEEEEEcccEEccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHccc //