[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36843.1
DDBJ      :             exodeoxyribonuclease, small subunit
Swiss-Prot:EX7S_THEP1   RecName: Full=Exodeoxyribonuclease 7 small subunit;         EC=3.1.11.6;AltName: Full=Exodeoxyribonuclease VII small subunit;         Short=Exonuclease VII small subunit;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.7.13
:70 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->58 1vp7E PDBj 2e-06 46.2 %
:RPS:SCOP  2->57 1vp7A  a.7.13.1 * 7e-08 37.5 %
:HMM:SCOP  1->64 1vp7B_ a.7.13.1 * 4.1e-14 43.8 %
:HMM:PFM   1->48 PF02609 * Exonuc_VII_S 1.7e-22 47.9 48/53  
:BLT:SWISS 1->70 EX7S_THEP1 1e-35 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36843.1 GT:GENE AAD36843.1 GT:PRODUCT exodeoxyribonuclease, small subunit GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1745707..1745919 GB:FROM 1745707 GB:TO 1745919 GB:DIRECTION + GB:PRODUCT exodeoxyribonuclease, small subunit GB:NOTE similar to GB:D00694 SP:P22938 PID:216583 GB:U00096 PID:1773106 percent identity: 70.31; identified by sequence similarity; putative GB:PROTEIN_ID AAD36843.1 GB:DB_XREF GI:4982358 LENGTH 70 SQ:AASEQ MMKELEEIVNRLENEDLPLEESIKLFERGVELYRKCKEILQQNRLKIIDVMKELEGEIDASGRDQENELR GT:EXON 1|1-70:0| SW:ID EX7S_THEP1 SW:DE RecName: Full=Exodeoxyribonuclease 7 small subunit; EC=3.1.11.6;AltName: Full=Exodeoxyribonuclease VII small subunit; Short=Exonuclease VII small subunit; SW:GN Name=xseB; OrderedLocusNames=Tpet_1057; SW:KW Complete proteome; Cytoplasm; Exonuclease; Hydrolase; Nuclease. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->70|EX7S_THEP1|1e-35|100.0|70/75| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004527|"GO:exonuclease activity"|Exonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| BL:PDB:NREP 1 BL:PDB:REP 2->58|1vp7E|2e-06|46.2|52/66| HM:PFM:NREP 1 HM:PFM:REP 1->48|PF02609|1.7e-22|47.9|48/53|Exonuc_VII_S| RP:SCP:NREP 1 RP:SCP:REP 2->57|1vp7A|7e-08|37.5|56/68|a.7.13.1| HM:SCP:REP 1->64|1vp7B_|4.1e-14|43.8|64/0|a.7.13.1|1/1|XseB-like| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 74.3 SQ:SECSTR #HHHHHHHHHH#HTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHH####HHHHHHH############ DISOP:02AL 61-70| PSIPRED cHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //