[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36849.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->37 PF09723 * CxxC_CxxC_SSSS 1.8e-07 34.3 35/42  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36849.1 GT:GENE AAD36849.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1762710..1762889) GB:FROM 1762710 GB:TO 1762889 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36849.1 GB:DB_XREF GI:4982365 LENGTH 59 SQ:AASEQ MPYIYRCKKCGAIYYSATSIEYQLNKYCEKCGGELEQLGEEGEVMEKEEEKKSEKKKKE GT:EXON 1|1-59:0| SEG 29->58|ekcggeleqlgeegevmekeeekksekkkk| HM:PFM:NREP 1 HM:PFM:REP 3->37|PF09723|1.8e-07|34.3|35/42|CxxC_CxxC_SSSS| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-59| PSIPRED ccccHHHHHccEEEEcccHHHHHHHHHHHHHccHHHHcccccccccHHHHHHHHHHccc //