[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36861.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   99->157 PF01930 * Cas_Cas4 3e-06 35.6 %
:HMM:PFM   5->158 PF01930 * Cas_Cas4 4.1e-47 42.2 154/162  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36861.1 GT:GENE AAD36861.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1773929..1774408) GB:FROM 1773929 GB:TO 1774408 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 63.12; identified by sequence similarity; putative GB:PROTEIN_ID AAD36861.1 GB:DB_XREF GI:4982378 LENGTH 159 SQ:AASEQ MMISGSVVLSYINCKREAWLMAHGVLPDQGNMHIEIGRFIHEDYSDSVMLPGMKIDTMFEREGVRVVGEVKKSSASKRGAEYQLLYYLYRLEEKGVKARGEIIVPKENKRIPVELTEENREKIKKVLEEVSSLLEEETPPPPKRKGICRKCGYELFCFS GT:EXON 1|1-159:0| SEG 61->74|regvrvvgevkkss| SEG 81->93|eyqllyylyrlee| SEG 126->137|vleevsslleee| RP:PFM:NREP 1 RP:PFM:REP 99->157|PF01930|3e-06|35.6|59/158|Cas_Cas4| HM:PFM:NREP 1 HM:PFM:REP 5->158|PF01930|4.1e-47|42.2|154/162|Cas_Cas4| OP:NHOMO 24 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------11----------------------------1--------------------------------------------------------------------------------------------------------1------------------------1------1112111--1---11----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 159-160| PSIPRED cEEcEEEEEEEEEcHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEccccEEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc //