[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36863.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->167 PF09704 * Cas_Cas5d 8e-04 30.4 %
:HMM:PFM   3->155 PF09704 * Cas_Cas5d 8.6e-22 22.0 150/216  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36863.1 GT:GENE AAD36863.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1776561..1777223) GB:FROM 1776561 GB:TO 1777223 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36863.1 GB:DB_XREF GI:4982380 LENGTH 220 SQ:AASEQ MKVLVFDVSAPYALFRRPYTTTSSYTLPFPPRTTLLGLVGCVLGYSTPERLDSAKVAVQIKNPLKFLRTGTNFVETKKDKKASKRTRISLQLLKNPAYRVFFSWEDEDFERLKNLLEHSETIFTPYLGVASFIARLNYVGKYEATRVADFPCEVHTVVPNTVKLLPEPSHYLIFERVTRKMDKERNMLESAVYIFKRDLSPVKVEGGEVWRVGEQNIVWM GT:EXON 1|1-220:0| SEG 35->44|llglvgcvlg| RP:PFM:NREP 1 RP:PFM:REP 4->167|PF09704|8e-04|30.4|161/189|Cas_Cas5d| HM:PFM:NREP 1 HM:PFM:REP 3->155|PF09704|8.6e-22|22.0|150/216|Cas_Cas5d| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN ---------------------------1-----1---1----1-----1---1--------------- ----------------------------------------------------------------------------------1---1-----------------------------------------------------------------------------------------------------11----------------------------1--------------------------------------------------------------------------------------------------------1------------------------1------------1----11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-84| PSIPRED ccEEEEEEEcccccEEccccEEEEEEcccccHHHHHHHHHHHHccccHHHEEEEEEEEEEccccEEEEEEEEEEEEcccccccccccEEEEEEEcEEEEEEEEEcccHHHHHHHHHHcccEEEEcccccccccccccEEEEEEEEEccccEEEEEEEcccEEEEEccccEEEEEccEEHEccccEEHHHHHHHHHHcccccEEEEccEEEEEccEEEEEc //