[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36873.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->127 PF03750 * DUF310 4e-11 44.7 %
:HMM:PFM   10->131 PF03750 * DUF310 3.3e-40 48.6 111/119  
:BLT:SWISS 15->131 Y1670_METJA 2e-07 29.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36873.1 GT:GENE AAD36873.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(1786260..1786682) GB:FROM 1786260 GB:TO 1786682 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD36873.1 GB:DB_XREF GI:4982391 LENGTH 140 SQ:AASEQ MAVSQGVSLKEDLKDLVRKAEEIGRELSGKLKTNQLRKFHGHLTKIWSNYIYKKKDYRDNPEKFNEEILNELHFMKIFLAYQVGRDIEGISELKEILEPLIDEIKTPDEFEKFKKFYDAILAYHKFHSESEKSNRRTARR GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 15->131|Y1670_METJA|2e-07|29.7|101/133| RP:PFM:NREP 1 RP:PFM:REP 16->127|PF03750|4e-11|44.7|103/118|DUF310| HM:PFM:NREP 1 HM:PFM:REP 10->131|PF03750|3.3e-40|48.6|111/119|DUF310| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 129-140| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //