[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD36879.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.5
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->115 1t3vA PDBj 2e-62 100.0 %
:RPS:SCOP  2->107 1o13A  c.55.5.1 * 5e-36 99.1 %
:HMM:SCOP  1->124 1t3vA_ c.55.5.1 * 6.4e-42 42.7 %
:RPS:PFM   17->100 PF02579 * Nitro_FeMo-Co 2e-05 34.9 %
:HMM:PFM   14->104 PF02579 * Nitro_FeMo-Co 1.9e-27 45.6 90/94  
:BLT:SWISS 1->109 Y580_METJA 3e-07 28.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD36879.1 GT:GENE AAD36879.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 1791991..1792365 GB:FROM 1791991 GB:TO 1792365 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 65.04; identified by sequence similarity; putative GB:PROTEIN_ID AAD36879.1 GB:DB_XREF GI:4982398 LENGTH 124 SQ:AASEQ MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 1->109|Y580_METJA|3e-07|28.2|103/100| SEG 116->123|hdhhhheh| BL:PDB:NREP 1 BL:PDB:REP 1->115|1t3vA|2e-62|100.0|115/124| RP:PFM:NREP 1 RP:PFM:REP 17->100|PF02579|2e-05|34.9|83/94|Nitro_FeMo-Co| HM:PFM:NREP 1 HM:PFM:REP 14->104|PF02579|1.9e-27|45.6|90/94|Nitro_FeMo-Co| RP:SCP:NREP 1 RP:SCP:REP 2->107|1o13A|5e-36|99.1|106/107|c.55.5.1| HM:SCP:REP 1->124|1t3vA_|6.4e-42|42.7|124/0|c.55.5.1|1/1|Nitrogenase accessory factor-like| OP:NHOMO 73 OP:NHOMOORG 64 OP:PATTERN --1-----------------1111-----1----1----------12112111---11111------- ------------------------------------------------------------------------------------------------------------------------------1--1-111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1111111-1-----1--------1----11131-11-1-111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1----------------11------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1121211--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 92.7 SQ:SECSTR cEEEcEEccccGGGccccccGGGccEEEEEEccTTccccEEEEEcTTccccccTHHHHHHTTTTccEEEEccccHHHHHHHHHHTcEEEEcccccHHHHHHHHHTTccccccccc######### DISOP:02AL 112-124| PSIPRED cEEEEEEccccccccccccccccccEEEEEEEcccEEEEEEEEccccccccccccHHHHHHHccccEEEEccccHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccccccccccccccccc //